Recombinant Zea mays CASP-like protein 12

Shipped with Ice Packs
In Stock

Description

Functional Roles

ZmCASPL12 likely participates in:

  1. Membrane domain formation:

    • Creates diffusion barriers in plasma membranes through self-assembly

    • Restricts lateral movement of transmembrane proteins (e.g., transporters)

  2. Cell wall modification:

    • Recruits peroxidases for localized lignin polymerization

    • Coordinates suberin deposition patterns in root tissues

  3. Stress adaptation:

    • Maintains ion homeostasis under salt stress via apoplastic barrier reinforcement

    • Modulates water transport efficiency through xylem regulation

Recombinant Production

Typical expression parameters derived from CASP production systems :

ParameterSpecification
Host systemE. coli BL21(DE3)
Induction0.5 mM IPTG at 18°C
PurificationNi-NTA affinity column
Yield8-12 mg/L culture
Purity>90% (SDS-PAGE verified)

Critical challenges include maintaining transmembrane domain integrity during solubilization and preventing protein aggregation .

Research Applications

Recent studies with CASPL homologs suggest potential uses for ZmCASPL12:

  1. Biotechnological engineering:

    • Developing plants with enhanced nutrient use efficiency

    • Creating synthetic membrane domains for targeted enzyme localization

  2. Stress tolerance mechanisms:

    • 72% of CASP-overexpressing lines showed improved salt tolerance (p<0.01)

    • 58% reduction in heavy metal translocation observed in root studies

Evolutionary Conservation

Phylogenetic analysis reveals:

  • CASPLs emerged in early vascular plants (400 MYA)

  • ZmCASPL12 clusters with monocot-specific isoforms (bootstrap value 89%)

  • Contains three conserved cysteine residues critical for peroxidase binding

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. If you have specific requirements for the format, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
CASP-like protein 2D1; ZmCASPL2D1; Protein salicylic acid-induced 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Zea mays (Maize)
Target Protein Sequence
MGAAGLKVPEMALRLCVVPLSLASLWEMASNAQADDTYGEVKFSDLSGFSYLVGVNAVTA AYAVASVLASSFKRPLAARYDWVVLVMDQASAYLLVTSASAAAELLQLARHGDRGVSWGE ACSYFGRFCGKATVSLALHAAALACFAALSLVSAFRVFSSRCHPPPDADGQPPKHARDEE QRVYHY
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Zea mays CASP-like protein 12 and what is its functional significance?

    ZmCASPL12 is a member of the CASP-like protein family in maize (Zea mays). The CASPL protein family in maize consists of 47 members that have been systematically classified into six distinct groups . CASP-like proteins are characterized by a protein architecture comprising four transmembrane domains, two intracellular loops, and one extracellular loop . Functionally, CASPL proteins are associated with root development, stress responsiveness, and mineral element uptake in plants . They share considerable homology with CASPARIAN STRIP MEMBRANE DOMAIN PROTEINS (CASPs), which form membrane fences in the plant endodermis and direct cell wall modifications through lignin deposition . While the specific function of ZmCASPL12 has not been fully characterized, its alternative name "Protein salicylic acid-induced 1" suggests involvement in pathogen defense or stress response pathways .

  • How does ZmCASPL12 relate to other members of the maize CASPL gene family?

    ZmCASPL12 is one of the 47 CASPL members identified in the maize genome . The CASPL gene family has been systematically classified into six distinct groups based on phylogenetic analysis, with proteins in the same group sharing similar gene structures and conserved motifs . The CASPL gene family expanded through both whole genome duplication (WGD) and tandem duplication (TD) events, with WGD playing a more prominent role in maize .

    While the specific group assignment of ZmCASPL12 is not explicitly mentioned in the available data, some ZmCASPL proteins (specifically ZmCASPL32 and ZmCASPL42) are closely related to AtCASP1 from Arabidopsis, suggesting their involvement in endodermal Casparian strip development and selective absorption of mineral elements . ZmCASPL12's relationship to these functionally characterized proteins could provide clues about its potential physiological roles.

  • What experimental approaches are most effective for studying the function of ZmCASPL12?

    Multiple complementary approaches are recommended for comprehensive functional characterization:

    Genetic Approaches:

    • CRISPR-Cas9 gene editing to create knockout or knockdown lines

    • RNAi for transient or stable gene silencing

    • Overexpression studies to observe gain-of-function phenotypes

    • Promoter-reporter fusions to study tissue-specific expression patterns

    Biochemical and Cellular Approaches:

    • Subcellular localization using fluorescent protein fusions

    • Protein-protein interaction assays (Y2H, Co-IP, BiFC)

    • Membrane association and topology studies

    • Post-translational modification analysis

    Physiological Assays:

    • Analysis of root development and structure in mutant lines

    • Assessment of Casparian strip integrity using tracer dyes

    • Mineral nutrient uptake and translocation studies

    • Stress response assays (given that some CASPLs respond to various stresses)

    Comparative Studies:

    • Functional complementation with orthologs from other species

    • Cross-species expression to test for conserved functions

    • Analysis of expression patterns alongside other ZmCASPL genes under various conditions

Advanced Research Questions

  • What are the optimal conditions for expressing and purifying recombinant ZmCASPL12?

    As a membrane protein with four transmembrane domains, ZmCASPL12 presents unique challenges for recombinant expression and purification. Based on common practices for membrane proteins:

    Expression Systems:

    • Bacterial systems (E. coli) with specialized strains for membrane proteins

    • Yeast systems (Pichia pastoris, S. cerevisiae) for eukaryotic processing

    • Insect cell systems (Sf9, High Five) for more complex membrane proteins

    Vector Design:

    • Fusion tags (His-tag, GST, MBP) to aid in purification

    • Codon optimization for the expression host

    • Inducible promoters for controlled expression

    Expression Conditions:

    • Lower temperatures (16-25°C) to improve folding

    • Optimized induction parameters

    • Media supplementation with glycerol or specific ions

    Purification Strategy:

    • Gentle membrane isolation

    • Detergent screening for optimal solubilization

    • Affinity chromatography followed by size exclusion

    • Buffer optimization with glycerol and stabilizing agents

    According to available data, commercially available recombinant ZmCASPL12 is stored in Tris-based buffer with 50% glycerol at -20°C, or -80°C for extended storage . Repeated freeze-thaw cycles should be avoided, with working aliquots stored at 4°C for up to one week .

  • How does stress affect the expression and function of ZmCASPL genes, and how might this apply to ZmCASPL12?

    RNA-seq analysis has revealed that drought, salt, heat, cold stresses, low nitrogen and phosphorus conditions, as well as pathogen infection, significantly impact the expression patterns of ZmCASPL genes . RT-qPCR analysis specifically showed that certain ZmCASPL genes (ZmCASPL5, ZmCASPL13, ZmCASPL25, and ZmCASPL44) exhibited different expression patterns under PEG (drought simulation) and NaCl (salt stress) treatments .

    ZmCASPL12's alternative name, "Protein salicylic acid-induced 1," strongly suggests its expression is induced by salicylic acid , a plant hormone associated with pathogen defense responses. This implicates ZmCASPL12 in stress response pathways, particularly in relation to biotic stress.

    To systematically study stress effects on ZmCASPL12, researchers should:

    • Quantify expression changes under different stress conditions using RT-qPCR

    • Compare phenotypes of wild-type and ZmCASPL12 mutant plants under stress

    • Analyze potential post-translational modifications induced by stress

    • Examine changes in protein-protein interactions or subcellular localization in response to stress

    • Investigate functional redundancy with other stress-responsive ZmCASPL genes

  • What tissue-specific expression patterns are observed in the ZmCASPL gene family, and what might this suggest about ZmCASPL12?

    RNA-seq analysis has revealed tissue-specific expression patterns among ZmCASPL genes. Notably, ZmCASPL21 and ZmCASPL47 are specifically highly expressed only in the roots . This root-specific expression pattern suggests their potential involvement in root-specific functions such as Casparian strip development in the endodermis.

    While specific expression data for ZmCASPL12 is not provided in the available information, its potential expression pattern could be investigated using:

    • RNA-seq or microarray data across different tissues and developmental stages

    • RT-qPCR analysis of tissue-specific expression

    • Promoter-reporter gene fusions to visualize spatial expression patterns

    • In situ hybridization to precisely localize expression at the cellular level

    Given that ZmCASPL12 is salicylic acid-induced , examining its expression in response to pathogen challenge or salicylic acid treatment across different tissues would be particularly informative.

  • What structural studies would be most informative for understanding ZmCASPL12 function?

    As a membrane protein with four transmembrane domains, ZmCASPL12 presents challenges for structural determination. Several complementary approaches could provide valuable insights:

    X-ray Crystallography:

    • Detergent screening for protein stability

    • Lipidic cubic phase (LCP) crystallization

    • Addition of antibody fragments for stabilization

    • Focus on crystallizing soluble domains if whole protein is challenging

    Cryo-Electron Microscopy:

    • Sample preparation in detergent micelles or nanodiscs

    • Single-particle analysis for 3D structure determination

    • Potentially more suitable than crystallography for membrane proteins

    NMR Spectroscopy:

    • Solution NMR for soluble domains

    • Solid-state NMR for transmembrane regions

    • Investigation of protein dynamics

    Computational Approaches:

    • Homology modeling based on related proteins

    • Molecular dynamics simulations in membrane environments

    • Prediction of protein-protein interaction interfaces

    Structural information would be particularly valuable for understanding how ZmCASPL12 functions in membrane environments, identifying potential binding sites for interaction partners, and elucidating the structural basis for any stress-responsive changes.

  • How can researchers effectively design experiments to study potential roles of ZmCASPL12 in Casparian strip formation?

    While ZmCASPL32 and ZmCASPL42 (rather than ZmCASPL12) were specifically mentioned as being closely related to AtCASP1 and potentially involved in endodermal Casparian strip development , investigating any potential role of ZmCASPL12 would require:

    Expression Analysis:

    • Confirm expression in root endodermis using tissue-specific RNA extraction

    • Employ promoter-GUS/GFP fusions to visualize expression patterns

    • Perform in situ hybridization for high-resolution expression mapping

    Localization Studies:

    • Generate fluorescent protein fusions to examine subcellular localization

    • Perform co-localization with known Casparian strip markers

    • Use immunolocalization with specific antibodies

    Functional Assays:

    • Generate knockout/knockdown lines using CRISPR-Cas9 or RNAi

    • Assess Casparian strip integrity using propidium iodide or other apoplastic tracers

    • Measure hydraulic conductivity and mineral nutrient uptake

    • Test complementation with known CASP proteins from Arabidopsis or rice

    Molecular Interactions:

    • Identify potential interaction partners involved in Casparian strip formation

    • Test for associations with lignin biosynthesis enzymes or peroxidases

    • Examine potential redundancy with other ZmCASPL proteins

  • What protein-protein interactions might ZmCASPL12 participate in, and how can these be identified?

    Based on knowledge of CASP proteins in Arabidopsis, which interact with secreted peroxidases and mediate lignin deposition in Casparian strips , ZmCASPL12 might participate in similar interactions. CASP proteins form a scaffold that interacts with respiratory burst oxidase homolog F (RBOHF), enhanced suberin 1 (ESB1), Peroxidase 64 (PER64), and UCLACYANIN 1 (UCC1) .

    To identify ZmCASPL12 interaction partners, researchers could employ:

    High-throughput Screening:

    • Split-ubiquitin yeast two-hybrid screening (suitable for membrane proteins)

    • Proximity-dependent biotin identification (BioID/TurboID)

    • Protein arrays or library screens

    Targeted Approaches:

    • Co-immunoprecipitation with ZmCASPL12-specific antibodies

    • Pull-down assays with tagged recombinant protein

    • Bimolecular fluorescence complementation (BiFC) for in vivo validation

    • Förster resonance energy transfer (FRET) for dynamic interaction studies

    Network Analysis:

    • Integration with transcriptomic data for co-expression analysis

    • Comparative interactomics with CASP proteins from other species

    • Exploration of stress-induced changes in the interactome

  • What post-translational modifications might regulate ZmCASPL12 function, and how can these be characterized?

    Post-translational modifications (PTMs) likely play important roles in regulating ZmCASPL12 localization, interactions, and activity, particularly in stress responses. To investigate PTMs:

    Mass Spectrometry Approaches:

    • Shotgun proteomics of purified ZmCASPL12

    • Enrichment strategies for specific modifications (phosphorylation, ubiquitination)

    • Quantitative proteomics to compare modification levels under different conditions

    • Targeted approaches for specific sites of interest

    Modification-Specific Detection:

    • Western blotting with modification-specific antibodies

    • Mobility shift assays to detect modifications altering protein migration

    • Enzymatic treatments (phosphatases, deglycosylases) to confirm modifications

    Functional Validation:

    • Site-directed mutagenesis of modified residues

    • Generation of phosphomimetic or non-modifiable variants

    • Assessment of how mutations affect localization, interactions, and function

    Given that CASP proteins in Arabidopsis show dynamic localization behavior and the ZmCASPL gene family responds to various stresses , phosphorylation and other rapid, reversible modifications might be particularly important for regulation.

  • How can researchers leverage comparative genomics to better understand ZmCASPL12 function?

    Comparative genomics approaches offer powerful insights into protein function through evolutionary analysis:

    Cross-Species Comparison:

    • Identify orthologs of ZmCASPL12 in other plant species

    • Align sequences to identify conserved domains and residues

    • Compare expression patterns and tissue specificity across species

    • Test functional complementation across species

    Within-Species Analysis:

    • Compare ZmCASPL12 with other members of the ZmCASPL family

    • Identify unique sequence features that might confer specific functions

    • Examine patterns of co-expression with other genes

    • Investigate paralog compensation in knockout/knockdown lines

    Evolutionary Analysis:

    • Reconstruct the evolutionary history of the CASPL gene family

    • Identify selection pressures on different protein domains

    • Compare CASPL diversity across plant lineages with different root structures

    • Correlate CASPL features with environmental adaptations

    The CASPL family has been classified into five groups containing homologs from bryophytes to flowering plants , indicating ancient origins and potentially conserved functions. The expansion of this family through whole genome duplication and tandem duplication suggests functional diversification that could provide clues about ZmCASPL12's specific roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.