Recombinant Zea mays CASP-like protein 13

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CASP-like protein 2C1; ZmCASPL2C1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Zea mays (Maize)
Target Protein Sequence
MVAAARVVSGVKAEGLLRGACAALAAAAALLLGLSTQTETVLLVRKKGTVKDVQALWVLA MAAASAAGYHLLQLLKCLYLGRGGGRALAWTCLLLDKACAYATFATTVAAAQACVVALDG AHALQWTKLCNIYTRFCEQVAGSLVLGMLAAVGTAVLSAASARNVFRHYYCSSHSPPAPP PETCDAH
Uniprot No.

Target Background

Database Links

KEGG: zma:100285613

UniGene: Zm.125147

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural classification of Recombinant Zea mays CASP-like protein 13?

Recombinant Zea mays CASP-like protein 13 (ZmCASPL13) belongs to the CASP-like protein family, which exhibits profound associations with root development, stress responsiveness, and mineral element uptake in plants. The comprehensive bioinformatics analysis of the ZmCASPL gene family has identified 47 ZmCASPL members at the whole-genome level, systematically classified into six distinct groups . Unlike most ZmCASPL proteins that contain CASP domains (approximately 72%), ZmCASPL13 contains a MARVEL domain instead, along with ZmCASPL5, ZmCASPL8, ZmCASPL32, ZmCASPL47, ZmCASPL10, ZmCASPL35, and ZmCASPL39 . This structural distinction may suggest unique functional properties within the CASPL family.

What are the known physicochemical properties of ZmCASPL13?

While the search results don't provide specific physicochemical properties for ZmCASPL13, the recombinant protein is typically produced in E. coli expression systems with a purity of >85% as determined by SDS-PAGE . Based on general properties of CASPL proteins, the molecular weight, isoelectric point, and solubility characteristics would be critical parameters for experimental design. For storage and stability, it is recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C . Repeated freezing and thawing is not recommended, and working aliquots should be stored at 4°C for up to one week.

What is the current understanding of ZmCASPL13's role in maize?

Research suggests that ZmCASPL13, like other members of the CASPL family, may be involved in stress response mechanisms in maize. RNA-seq analysis has illuminated that drought, salt, heat, cold stresses, low nitrogen and phosphorus conditions, as well as pathogen infection, significantly impact the expression patterns of ZmCASPL genes . Specifically, RT-qPCR revealed that ZmCASPL13, along with ZmCASPL5, ZmCASPL25, and ZmCASPL44, showed different expression patterns under polyethylene glycol (PEG) and NaCl treatments, suggesting roles in drought and salt stress responses .

How should researchers design expression studies for ZmCASPL13 under various stress conditions?

When designing expression studies for ZmCASPL13 under stress conditions, researchers should:

  • Establish appropriate control and treatment groups: Include untreated controls, time-course samplings, and multiple stress intensities.

  • Consider tissue specificity: Some CASPL genes show tissue-specific expression patterns. For instance, ZmCASPL21 and ZmCASPL47 are specifically highly expressed only in the roots .

  • Design primers for RT-qPCR: Design specific primers spanning exon-exon junctions to avoid genomic DNA amplification. For ZmCASPL13, consider its exon structure when designing primers.

  • Validate with multiple reference genes: Use at least 2-3 stable reference genes for normalization under the specific stress conditions being tested.

  • Include positive controls: Include known stress-responsive genes (e.g., DREB family genes for cold stress) as positive controls to validate the stress treatment.

  • Perform time-course experiments: Monitor expression at multiple time points to capture both early and late responses to stress.

Analysis of expression patterns in response to various stresses (as done for ZmCASPL5, ZmCASPL13, ZmCASPL25, and ZmCASPL44) can provide insights into the functional roles of ZmCASPL13 in stress adaptation .

What are the optimal conditions for reconstitution and storage of recombinant ZmCASPL13?

For optimal reconstitution and storage of recombinant ZmCASPL13:

  • Centrifugation before opening: Briefly centrifuge the vial prior to opening to bring contents to the bottom.

  • Reconstitution: Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Glycerol addition: Add 5-50% glycerol (final concentration) to prevent freezing damage and maintain stability. The default recommended final concentration is 50%.

  • Aliquoting: Create small working aliquots to avoid repeated freeze-thaw cycles.

  • Storage temperature: Store working aliquots at 4°C for up to one week. For long-term storage, keep at -20°C/-80°C.

  • Shelf life: The shelf life of liquid form is typically 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C .

What methods are most effective for studying protein-protein interactions involving ZmCASPL13?

To study protein-protein interactions involving ZmCASPL13, researchers can employ several complementary approaches:

  • Co-immunoprecipitation (Co-IP): Use antibodies against ZmCASPL13 to pull down protein complexes from plant tissue lysates, followed by mass spectrometry to identify interacting partners.

  • Yeast two-hybrid (Y2H): Create fusion constructs with ZmCASPL13 as bait to screen for potential interacting proteins from a maize cDNA library.

  • Bimolecular Fluorescence Complementation (BiFC): Fuse ZmCASPL13 with one half of a fluorescent protein and potential interacting partners with the complementary half to visualize interactions in planta.

  • Proximity-dependent biotin identification (BioID): Fuse ZmCASPL13 with a biotin ligase to biotinylate proximal proteins, which can then be purified and identified by mass spectrometry.

  • In silico prediction: Use computational approaches to predict potential interactions based on structural similarities with known interacting CASP domain proteins.

Since CASPs interact with secreted peroxidases to mediate the deposition of lignin during Casparian strip formation , similar approaches could be employed to investigate whether ZmCASPL13 interacts with peroxidases or other cell wall modification enzymes.

How do different abiotic stresses affect ZmCASPL13 expression patterns?

Analysis of ZmCASPL13 expression under various abiotic stress conditions reveals distinct response patterns:

  • Drought stress: RT-qPCR analysis revealed that ZmCASPL13 shows altered expression patterns under PEG treatment, which mimics drought conditions .

  • Salt stress: ZmCASPL13 exhibits differential expression under NaCl treatment, suggesting a role in salt stress response mechanisms .

  • Temperature stress: RNA-seq analysis has shown that heat and cold stresses significantly impact the expression patterns of ZmCASPL genes, including ZmCASPL13 .

  • Nutrient deficiency: Low nitrogen and phosphorus conditions affect the expression of ZmCASPL genes, which may indicate a role in nutrient uptake regulation .

Transcriptome analyses have revealed that these stress conditions significantly impact the expression patterns of ZmCASPL genes, suggesting their involvement in multiple stress response pathways .

What transcription factors are known to regulate ZmCASPL13 expression?

While specific transcription factors regulating ZmCASPL13 have not been directly identified in the search results, analysis of the ZmCASPL gene family revealed that most ZmCASPL genes contain MYB-binding sites (CAACCA), which are associated with the Casparian strip . This suggests that MYB transcription factors, particularly MYB36, may play a role in regulating ZmCASPL13 expression.

Research in Arabidopsis has shown that the transcription factor MYB36 directly regulates the expression of the main genes involved in Casparian strip formation . A similar regulatory mechanism might exist in maize, where MYB transcription factors could regulate ZmCASPL13 expression.

The presence of bZIP transcription factors might also be relevant, as seen in the case of bZIP68 which negatively regulates cold tolerance in maize by binding to promoters of target genes . Future research could investigate whether similar transcription factors interact with ZmCASPL13 promoter regions.

What CRISPR-based approaches can be used to study ZmCASPL13 function?

Several CRISPR-based approaches can be employed to study ZmCASPL13 function:

  • Gene knockout using CRISPR/Cas9:

    • Design guide RNAs targeting exons of ZmCASPL13

    • Generate frameshift mutations to create loss-of-function mutants

    • Screen for homozygous mutants for phenotypic analysis

  • Base editing:

    • Use CRISPR-Cas9 nickase fused with deaminases to introduce specific point mutations

    • Create amino acid substitutions at key residues to study structure-function relationships

  • CRISPRi (CRISPR interference):

    • Use catalytically dead Cas9 (dCas9) fused to repressor domains to downregulate ZmCASPL13 expression

    • Target the promoter region for transcriptional repression

  • CRISPRδ for translational repression:

    • Employ catalytically inactive Cas13 proteins (dCas13) to block translation

    • Design guide RNAs covering the start codon for highest efficacy

    • This approach provides ultrahigh gene silencing specificity as demonstrated by genome-wide ribosome profiling

  • CRISPR activation (CRISPRa):

    • Use dCas9 fused to activator domains to upregulate ZmCASPL13 expression

    • Target the promoter region for transcriptional activation

This multi-faceted approach would provide comprehensive insights into ZmCASPL13 function through both loss-of-function and gain-of-function analyses.

How can researchers generate and validate ZmCASPL13 mutants in maize?

To generate and validate ZmCASPL13 mutants in maize:

  • Design of CRISPR/Cas9 constructs:

    • Create guide RNAs targeting early exons of ZmCASPL13

    • Clone into appropriate vectors for maize transformation

    • Consider using promoters active in specific tissues for tissue-specific knockout

  • Transformation methods:

    • Use Agrobacterium-mediated transformation or particle bombardment

    • Target immature embryos or embryogenic callus

  • Screening for mutations:

    • Perform PCR amplification of the target region

    • Use T7 endonuclease I assay or sequencing to detect mutations

    • Design primers to detect larger deletions if multiple guide RNAs are used

  • Validation of mutants:

    • Sequence the target region to confirm mutations

    • Perform RT-PCR and Western blot to confirm reduction/absence of transcript and protein

    • Analyze segregation patterns in subsequent generations

  • Phenotypic analysis:

    • Evaluate root development and architecture

    • Test responses to various abiotic stresses (drought, salt, temperature extremes)

    • Examine Casparian strip formation using fluorescent dyes like berberine-aniline blue

    • Analyze mineral nutrient uptake and transport

For effective validation, researchers should create multiple independent mutant lines and perform complementation tests by introducing the wild-type ZmCASPL13 gene into the mutant background, as demonstrated in studies of other genes like OsCASP1 .

What phenotypic traits should researchers examine in ZmCASPL13 mutants?

Based on the known functions of CASP-like proteins, researchers should examine the following phenotypic traits in ZmCASPL13 mutants:

  • Root structure and development:

    • Root length, branching, and architecture

    • Lateral root formation and development

    • Root hair density and length

  • Stress tolerance:

    • Drought tolerance (water use efficiency, wilting response)

    • Salt tolerance (growth under various NaCl concentrations)

    • Temperature stress response (cold and heat tolerance)

    • Response to nutrient deficiency (particularly N and P)

  • Casparian strip formation:

    • Use improved clearing methods with lactic acid saturated with chloral hydrate

    • Apply berberine-aniline blue staining to visualize Casparian strips

    • Examine cross-sections of small lateral roots (SLRs)

    • Assess fluorescence patterns in endodermis and sclerenchyma

  • Mineral nutrient homeostasis:

    • Ion content analysis (Na+, K+, Ca2+, etc.)

    • Transpiration-dependent ion transport

    • Root-to-shoot transport of nutrients and toxic elements

  • Cell wall composition:

    • Lignin content and distribution

    • Suberin deposition patterns

    • Cell wall integrity under stress conditions

Since CASPL genes are involved in root development and stress responses, special attention should be given to how mutation of ZmCASPL13 affects these processes under various environmental conditions .

How does ZmCASPL13 compare to other CASP-like proteins in terms of evolution and function?

Evolutionary and functional comparison of ZmCASPL13 with other CASP-like proteins reveals several key insights:

  • Phylogenetic classification:

    • The ZmCASPL gene family has been classified into six distinct subfamilies (Groups I-VI)

    • ZmCASPL13 belongs to a specific subfamily that contains MARVEL domains rather than the typical CASP domains found in 72% of ZmCASPL proteins

  • Domain structure differences:

    • Unlike most ZmCASPL proteins that contain CASP domains, ZmCASPL13 contains a MARVEL domain

    • This domain distinction suggests potential functional divergence from canonical CASP proteins

  • Functional conservation and divergence:

    • CASP-like proteins from Arabidopsis (AtCASPL) and maize (ZmCASPL) share similar roles in membrane domain organization and cell wall modification

    • CASP proteins are involved in two key activities: forming membrane scaffolds and directing cell wall modifications, which can be uncoupled

    • ZmCASPL13's MARVEL domain may confer unique properties related to membrane organization

  • Evolutionary relationship to other protein families:

    • CASPL proteins show conservation with the MARVEL protein family, with conserved residues located in transmembrane domains

    • These transmembrane domains are likely involved in CASP protein localization

  • Species-specific adaptation:

    • The emergence of Casparian strips in the plant kingdom correlates with the appearance of a CASP-specific signature not found in plants lacking Casparian strips

Understanding these evolutionary relationships provides valuable context for functional studies of ZmCASPL13 and may help predict its specific roles in maize development and stress responses.

What are the potential applications of ZmCASPL13 in improving crop stress tolerance?

The potential applications of ZmCASPL13 in improving crop stress tolerance include:

  • Enhanced drought tolerance:

    • Modulating ZmCASPL13 expression could potentially improve water use efficiency by regulating Casparian strip formation

    • Modified water transport through roots could help plants better withstand drought conditions

  • Improved salt tolerance:

    • Given that ZmCASPL13 shows altered expression under salt stress , it may be involved in salt stress response mechanisms

    • Engineering ZmCASPL13 expression could potentially enhance transpiration-dependent salt tolerance (TDST), as observed with other Casparian strip-related proteins

  • Nutrient use efficiency:

    • By regulating the Casparian strip, modified ZmCASPL13 could improve nutrient uptake and translocation

    • This could lead to better growth under limited nutrient conditions

  • Engineering stress-responsive promoters:

    • The stress-responsive nature of ZmCASPL13 promoters could be utilized to drive expression of other stress tolerance genes

  • Cross-species applications:

    • Insights from ZmCASPL13 could be applied to other crop species to improve their stress tolerance

    • Comparative studies across species could identify conserved mechanisms for engineering

Research in rice has shown that OsCASP1 plays an important role in nutrient homeostasis and adaptation to growth environments . Similar mechanisms involving ZmCASPL13 could be exploited in maize to improve adaptation to challenging environmental conditions.

How can researchers integrate transcriptomic, proteomic, and metabolomic approaches to understand ZmCASPL13 function?

An integrated multi-omics approach to understand ZmCASPL13 function would involve:

  • Transcriptomics:

    • RNA-seq analysis of wild-type vs. ZmCASPL13 mutants under normal and stress conditions

    • Identification of differentially expressed genes and affected pathways

    • Analysis of co-expressed genes to identify potential functional networks

  • Proteomics:

    • Quantitative proteomics to identify protein abundance changes in ZmCASPL13 mutants

    • Phosphoproteomics to detect changes in signaling cascades

    • Protein-protein interaction studies using co-immunoprecipitation coupled with mass spectrometry

  • Metabolomics:

    • Targeted and untargeted metabolite profiling of roots and shoots

    • Analysis of stress-related metabolites in wild-type vs. mutant plants

    • Hormone profiling to detect changes in stress hormone levels

  • Phenomics:

    • High-throughput phenotyping under various environmental conditions

    • Root architecture analysis using specialized imaging techniques

    • Physiological measurements (photosynthesis, transpiration, etc.)

  • Integration strategies:

    • Network analysis to identify coordinated responses across multiple omics layers

    • Machine learning approaches to predict functional relationships

    • Pathway enrichment analysis across multiple omics datasets

  • Validation experiments:

    • Targeted experiments to verify key predictions from integrated analysis

    • CRISPR-based approaches to validate identified genetic interactions

    • Physiological tests to confirm predicted phenotypic outcomes

This multi-omics approach would provide a comprehensive understanding of ZmCASPL13's role in cellular processes and stress responses, potentially identifying novel targets for crop improvement strategies.

What are the main challenges in expressing and purifying recombinant ZmCASPL13?

The main challenges in expressing and purifying recombinant ZmCASPL13 include:

Addressing these challenges requires systematic optimization of expression conditions, purification protocols, and storage methods to obtain high-quality recombinant ZmCASPL13 for downstream applications.

How can researchers address potential immune responses when using recombinant CASP proteins in experimental systems?

While the search results don't specifically address immune responses to ZmCASPL13, studies on other recombinant proteins like Cas13d provide relevant insights:

  • Pre-existing adaptive immunity considerations:

    • Healthy individuals may have antibodies and T cells reactive to certain recombinant proteins

    • When using recombinant ZmCASPL13 in experimental systems, researchers should consider potential immune recognition

  • Antibody response assessment:

    • Test for pre-existing antibodies against ZmCASPL13 using ELISA assays

    • Consider using protein fragments or modified versions if antibody recognition is problematic

  • T cell response considerations:

    • T cell responses can occur against recombinant proteins, including both CD4 and CD8 T cell responses

    • These responses may involve production of inflammatory cytokines like IFN-γ, TNF-α, and IL-17

  • Mitigation strategies:

    • Protein engineering to remove immunogenic epitopes while maintaining function

    • Use of immunosuppressive agents in certain experimental systems

    • Consider shorter exposure periods to minimize immune responses

  • Endotoxin removal:

    • Ensure recombinant proteins are endotoxin-free to prevent non-specific immune activation

    • Use endotoxin removal columns or treatments during purification

    • Test final preparations with limulus amebocyte lysate (LAL) assays

  • Alternatives to consider:

    • Use of synthetic peptides representing functional domains

    • Cell-free expression systems to minimize contaminants

    • Species-matched proteins when working in animal models

These considerations are particularly important when designing experiments involving recombinant ZmCASPL13 in systems where immune responses could confound results or affect experimental outcomes.

What quality control measures should be implemented for ZmCASPL13 structural and functional studies?

For robust ZmCASPL13 structural and functional studies, implement these quality control measures:

  • Protein purity assessment:

    • SDS-PAGE analysis with target purity >85%

    • Western blotting with specific antibodies

    • Mass spectrometry for identity confirmation

    • Size exclusion chromatography to verify homogeneity

  • Structural integrity validation:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Thermal shift assays to determine stability

    • Limited proteolysis to evaluate domain organization

    • Dynamic light scattering (DLS) to check for aggregation

  • Functional activity assays:

    • Binding assays with predicted interaction partners

    • Membrane localization studies using fluorescently tagged proteins

    • In vitro reconstitution of protein complexes

  • Reproducibility measures:

    • Use multiple protein batches in key experiments

    • Implement standardized protocols with detailed documentation

    • Include appropriate positive and negative controls

    • Perform biological and technical replicates

  • Storage stability monitoring:

    • Regular testing of stored protein aliquots

    • Assessment of freeze-thaw effects on activity

    • Implementation of optimal storage conditions (glycerol addition, appropriate temperature)

  • Data validation approaches for structural studies:

    • Use multiple structure prediction methods (e.g., AlphaFold, RoseTTAFold)

    • Apply Critical Assessment of Structure Prediction (CASP) methodologies

    • Validate predictions with experimental data (e.g., crosslinking-MS, SAXS)

  • Endotoxin testing:

    • LAL assays to ensure preparations are endotoxin-free

    • Monitor for possible contamination during purification

What emerging technologies might advance our understanding of ZmCASPL13 function?

Several emerging technologies show promise for advancing our understanding of ZmCASPL13 function:

  • Advanced CRISPR technologies:

    • Base editing for precise genome modifications without double-strand breaks

    • Prime editing for targeted insertions and complex edits

    • CRISPRδ for translational silencing with ultrahigh specificity

    • CRISPR activation and interference for temporal control of gene expression

  • Single-cell omics approaches:

    • Single-cell RNA-seq to identify cell-specific expression patterns

    • Single-cell proteomics to detect cell-type-specific protein abundance

    • Spatial transcriptomics to map expression in tissue contexts

  • Advanced imaging techniques:

    • Super-resolution microscopy for detailed protein localization

    • Live-cell imaging with genetically encoded biosensors

    • Correlative light and electron microscopy (CLEM) for structural context

    • Label-free imaging methods for non-invasive tracking

  • Protein structure prediction and analysis:

    • AI-based structure prediction tools like AlphaFold2

    • Molecular dynamics simulations to study protein flexibility and interactions

    • In silico docking studies to predict protein-protein interactions

    • Critical Assessment of Structure Prediction (CASP) methodologies

  • Synthetic biology approaches:

    • Designed protein scaffolds for enhanced or modified function

    • Optogenetic tools for spatiotemporal control of protein activity

    • Engineered protein circuits for novel stress response pathways

  • Advanced phenotyping platforms:

    • High-throughput root phenotyping systems

    • Automated stress response monitoring

    • Field-based phenomics with drone and sensor technologies

These technologies, particularly when used in combination, have the potential to significantly accelerate our understanding of ZmCASPL13's role in plant development, stress responses, and potential applications in crop improvement.

What are the key unanswered questions about ZmCASPL13 and related proteins in plant stress responses?

Several critical unanswered questions remain regarding ZmCASPL13 and related proteins in plant stress responses:

  • Structure-function relationships:

    • How does the MARVEL domain in ZmCASPL13 contribute to its specific function?

    • What structural features determine membrane localization and protein-protein interactions?

    • How do post-translational modifications affect ZmCASPL13 activity?

  • Regulatory networks:

    • Which transcription factors directly regulate ZmCASPL13 expression under different stress conditions?

    • How is ZmCASPL13 expression coordinated with other stress-responsive genes?

    • What signaling pathways modulate ZmCASPL13 activity?

  • Functional redundancy:

    • To what extent do other ZmCASPL proteins compensate for ZmCASPL13 function?

    • Are there tissue-specific or stress-specific functional differences among ZmCASPL family members?

    • What is the extent of functional redundancy among ZmCASPL proteins, particularly those with high amino acid similarity?

  • Stress-specific mechanisms:

    • How does ZmCASPL13 specifically contribute to drought versus salt stress responses?

    • What role does ZmCASPL13 play in transpiration-dependent salt tolerance (TDST)?

    • How do ZmCASPL proteins participate in biotic stress responses?

  • Translation to crop improvement:

    • Can modulation of ZmCASPL13 expression enhance stress tolerance without yield penalties?

    • What natural variation exists in ZmCASPL13 across maize germplasm, and how does it correlate with stress adaptation?

    • How can knowledge of ZmCASPL13 function be applied to other crop species?

  • Evolutionary significance:

    • When did the MARVEL domain-containing CASPLs like ZmCASPL13 emerge during plant evolution?

    • How has this protein family diversified in response to different environmental pressures?

    • What is the evolutionary relationship between ZmCASPL13 and proteins in other plant species?

Addressing these questions will require integrative approaches combining structural biology, genetics, physiology, and systems biology to fully elucidate the role of ZmCASPL13 in plant stress responses and development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.