Recombinant Zea mays CASP-like protein 14

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Zea mays CASP-like protein 14 (UniProt: C4JAF2) is synthesized to replicate the native protein's structure, with technical specifications as follows:

PropertyDetails
Amino Acid Sequence302 residues starting with MALQAQQQATPSPTRDRAGSGEWLADTEKLPGAAASPEDVVVASTHH...
Molecular Weight~33 kDa (theoretical)
Expression RegionFull-length (residues 1–302)
TagUndisclosed (determined during production)
Storage ConditionsTris-based buffer with 50% glycerol; store at -20°C/-80°C
Key DomainsCASP-like domain, predicted transmembrane regions

This recombinant protein is optimized for experimental use in ELISA and other biochemical assays .

Biological Context and Homology

CASP-like proteins in plants are associated with:

  • Casparian strip formation: Membrane-bound scaffolds critical for root endodermal barrier development .

  • Stress adaptation: Regulation of ion transport and response to environmental stressors .

While direct functional data for Zea mays CASP-like protein 14 is sparse, homologs in Arabidopsis and rice (OsCASPs) reveal:

  • Expression specificity: Predominant in root tissues, particularly endodermal cells .

  • Evolutionary conservation: CASP-like proteins share transmembrane scaffolding features with MARVEL domain proteins, suggesting roles in membrane domain organization .

Current Use Cases

  • Biochemical studies: The recombinant protein serves as an antigen in immunoassays (e.g., ELISA) for antibody validation .

  • Structural analysis: Full-length expression enables investigations into membrane localization and interaction partners.

Unresolved Questions

  • Functional role: No peer-reviewed studies directly link this isoform to Casparian strip formation or stress responses in maize.

  • Regulatory mechanisms: Upstream signaling pathways (e.g., phosphoinositide metabolism) remain unexplored .

Comparative Analysis with Related Proteins

ProteinSpeciesFunctionKey Difference
ZmSEC14pZea maysCold stress tolerance via phospholipid signalingSec14-like domain, not CASP-like
AtCASP1ArabidopsisCasparian strip scaffoldDirect role in root barrier formation
OsCASP_like11RiceEndodermal ion transport regulationFunctional redundancy within gene family

Future Directions

  • Gene knockout studies: To elucidate in vivo roles in maize development.

  • Interaction profiling: Identify binding partners linked to membrane domain assembly.

  • Stress assays: Test recombinant protein’s impact on abiotic stress tolerance (e.g., salinity, drought).

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your desired format in the order notes, and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery information, please consult your local distributor.
Note: Our proteins are standardly shipped with blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be finalized during production. If you have a specific tag preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
CASP-like protein 4A2; ZmCASPL4A2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-302
Protein Length
full length protein
Species
Zea mays (Maize)
Target Protein Sequence
MALQAQQQATPSPTRDRAGSGEWLADTEKLPGAAASPEDVVVASTHHAAAAARYVPPRAT SHTAEPNPGRGGGGGWYSWNGGRRARHDPPAPRRQQPAKTPPPAPPLPAAPPPPPAASPA PAPRAPPPHAQVRSADRVVPAILSRKRRAAVMQRAALLARAAAAGLCLAALAVLASDTRR GWARDSYSNYAQFRYSEAVNVVGFLYSVFQFVALAELMRRNKHLIPHPKRDLFDFTMDQV VAYLLISSSSSATARASDLIENWGSDSFPSMANGSIAISFVAFVVFAICSLISAYNLFRR DM
Uniprot No.

Target Background

Database Links

KEGG: zma:100284695

UniGene: Zm.102865

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What structural characteristics define ZmCASPL14 and how can they be analyzed?

ZmCASPL14, as a member of the maize CASPL family, likely possesses four transmembrane domains with highly conserved sequences in the first (TM1) and third (TM3) transmembrane regions. To analyze these structural characteristics, researchers should employ hydropathy plot analysis and transmembrane prediction algorithms such as TMHMM or Phobius. For experimental verification, a combination of epitope tagging at predicted internal and external loops followed by protease protection assays can confirm the topology. Circular dichroism spectroscopy can further provide insights into secondary structure elements within the protein .

How should researchers approach expression analysis of ZmCASPL14 across different tissues?

For comprehensive expression profiling of ZmCASPL14, researchers should implement both RNA-seq and RT-qPCR analyses across various tissues and developmental stages. Based on patterns observed with other ZmCASPL genes, special attention should be paid to root tissues, particularly the endodermis, where many CASPL proteins exhibit specialized functions. The experimental design should include:

  • Collection of tissue samples from different developmental stages

  • RNA extraction using protocols optimized for plant tissues

  • cDNA synthesis with gene-specific primers

  • Quantitative PCR with reference genes specific for maize tissues

This approach would reveal whether ZmCASPL14 exhibits tissue-specific expression like ZmCASPL21 and ZmCASPL47, which show root-specific expression patterns .

What phylogenetic approaches best determine the evolutionary relationships of ZmCASPL14?

Researchers should conduct comprehensive phylogenetic analysis using both maximum likelihood and Bayesian inference methods to position ZmCASPL14 within the broader CASPL family. Multiple sequence alignment should be performed using MUSCLE or T-Coffee algorithms, with careful attention to the conserved transmembrane domains. Based on the classification of the CASPL family into six distinct groups, determining which group ZmCASPL14 belongs to would provide insights into its potential functional conservation. Phylogenetic trees should include CASPLs from diverse plant species, including Arabidopsis, as comparative references .

GroupNumber of ZmCASPLsNumber of AtCASPLsPotential Function
I41Diverse functions
II98Potential membrane domain formation
III56Potentially stress responsive
IV108Varied expression patterns
V99Possibly involved in development
VI1015Largest group, significant evolutionary importance

How can researchers effectively study the role of ZmCASPL14 in abiotic stress responses?

To investigate ZmCASPL14's role in stress responses, researchers should implement a multi-faceted approach:

  • Generate transgenic maize lines with ZmCASPL14 overexpression and CRISPR/Cas9-mediated knockouts

  • Subject these lines to controlled stress conditions (drought, salt, cold, heat)

  • Analyze phenotypic differences, particularly focusing on root architecture and development

  • Perform RNA-seq to identify downstream genes affected by ZmCASPL14 modification

  • Use RT-qPCR to validate expression changes under different stress conditions

This methodology is supported by evidence that other ZmCASPL genes (ZmCASPL5/13/25/44) show differential expression under PEG and NaCl treatments . Additionally, lessons from the study of ZmSEC14p, a maize protein that confers cold tolerance when overexpressed in Arabidopsis, suggest monitoring proline accumulation, antioxidant enzyme activities, and ROS levels in transgenic plants to assess stress tolerance mechanisms .

What approaches can determine if ZmCASPL14 participates in membrane domain formation?

Investigating ZmCASPL14's potential role in membrane domain formation requires advanced imaging and biochemical techniques:

  • Generate fluorescent protein fusions (ZmCASPL14-GFP) for expression in heterologous systems

  • Perform live-cell imaging using confocal microscopy to observe membrane localization patterns

  • Employ Fluorescence Recovery After Photobleaching (FRAP) to analyze protein mobility within membranes

  • Conduct co-expression studies with known domain-forming proteins like AtCASPs

  • Use Blue-Native PAGE to identify potential protein complexes

This approach builds on evidence that when ectopically expressed in Arabidopsis endodermis, most CASPL proteins can integrate into the CASP membrane domain, suggesting a shared propensity to form transmembrane scaffolds .

How should researchers investigate potential interactions between ZmCASPL14 and cell wall modification machinery?

To study ZmCASPL14's possible role in cell wall modification:

  • Perform co-immunoprecipitation experiments with epitope-tagged ZmCASPL14 followed by mass spectrometry

  • Use yeast two-hybrid or split-ubiquitin assays to screen for interactions with known cell wall enzymes

  • Implement proximity labeling techniques (BioID or APEX) to identify proteins in close proximity to ZmCASPL14

  • Analyze cell wall composition in ZmCASPL14 transgenic lines using biochemical and microscopy techniques

  • Examine co-expression patterns with genes encoding cell wall-modifying enzymes

This investigation is warranted because CASP proteins in Arabidopsis direct local cell wall modifications by interacting with secreted peroxidases and mediating lignin deposition .

What expression systems and purification strategies are optimal for producing recombinant ZmCASPL14?

For successful production of recombinant ZmCASPL14:

  • Compare expression in multiple systems:

    • E. coli with specialized strains for membrane proteins (C41, C43)

    • Yeast systems (P. pastoris) for eukaryotic post-translational modifications

    • Insect cell systems for complex membrane proteins

  • Optimize constructs with:

    • Codon optimization for the selected expression system

    • N- or C-terminal affinity tags (His, GST, MBP)

    • Fusion partners to enhance solubility

  • Extract using specialized detergents:

    • Screen detergents (DDM, LDAO, Fos-choline) for optimal solubilization

    • Implement detergent exchange during purification

  • Employ multi-step purification:

    • Immobilized metal affinity chromatography

    • Size exclusion chromatography

    • Ion exchange chromatography if needed

This approach addresses the challenges of membrane protein expression, particularly for proteins with multiple transmembrane domains like ZmCASPL14 .

What gene editing strategies would best elucidate ZmCASPL14 function in planta?

To implement effective gene editing for functional characterization:

  • Design CRISPR/Cas9 constructs targeting:

    • Conserved transmembrane domains

    • Potential functional motifs

    • Promoter regions for expression modulation

  • Create multiple edited lines:

    • Complete knockouts

    • Domain-specific mutations

    • Promoter modifications for altered expression

  • Validate edits using:

    • Targeted sequencing

    • RT-qPCR for expression analysis

    • Western blotting with specific antibodies

  • Perform complementation studies:

    • Re-introduce wild-type ZmCASPL14

    • Introduce mutated versions for structure-function analysis

    • Swap domains with other CASPL proteins

This comprehensive approach will help determine whether ZmCASPL14 functions similarly to characterized CASPs in Arabidopsis, which play roles in Casparian strip formation and endodermal barrier establishment .

How can researchers effectively analyze ZmCASPL14 promoter activity and regulation?

For detailed analysis of ZmCASPL14 promoter activity:

  • Isolate the promoter region (1-2 kb upstream of the transcription start site)

  • Generate promoter-reporter constructs (GUS, LUC, GFP)

  • Create a series of truncated promoter constructs to identify key regulatory elements

  • Perform in silico analysis to identify potential transcription factor binding sites

  • Verify binding using chromatin immunoprecipitation (ChIP) and electrophoretic mobility shift assays (EMSA)

Since many ZmCASPL genes contain MYB-binding sites (CAACCA) associated with Casparian strip development, special attention should be paid to potential MYB transcription factor binding sites in the ZmCASPL14 promoter .

What experimental design best demonstrates ZmCASPL14 function in mineral nutrient uptake?

To investigate ZmCASPL14's potential role in mineral nutrient uptake:

  • Establish hydroponic growth systems with controlled nutrient compositions

  • Compare ZmCASPL14 overexpression and knockout lines under different nutrient regimes

  • Analyze tissue-specific mineral content using ICP-MS

  • Perform radiotracer studies to track nutrient movement in real-time

  • Examine root anatomical changes in response to nutrient stress using histochemical staining and microscopy

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.