Sequence: Full-length ZmCASPL15 (306 amino acids) with a His tag for purification .
Domains: Predicted four transmembrane domains, consistent with CASP/CASPL family topology .
Production: Expressed in Escherichia coli for recombinant synthesis .
| Property | Detail |
|---|---|
| Host System | E. coli |
| Tag | Polyhistidine (His) |
| Molecular Weight | ~34 kDa (calculated) |
| UniProt Entry | Not yet assigned |
ZmCASPL15 is part of a conserved protein family critical for plant nutrient homeostasis. CASPLs are implicated in:
Membrane Scaffolding: Formation of stable plasma membrane domains, as observed in Arabidopsis CASPs .
Cell Wall Modification: Recruitment of peroxidases for lignin polymerization at Casparian strips .
CASPLs exist in land plants and green algae, with homology to animal MARVEL proteins involved in membrane organization .
ZmCASPL15 shares structural motifs with Arabidopsis CASP1/CASP3, which direct lignin deposition in endodermal cells .
Pathway Studies: ZmCASPL15 is hypothesized to participate in lignin biosynthesis pathways, though specific interactors remain uncharacterized .
Protein Interactions: Direct interactions with peroxidases or transporters are plausible based on Arabidopsis CASP models .
No peer-reviewed studies directly investigating ZmCASPL15’s biochemical roles were identified in the provided sources.
Commercial availability (e.g., Creative BioMart’s product RFL34737ZF) suggests its use in antibody production or in vitro assays .
Does ZmCASPL15 localize to Casparian strip domains in maize roots?
What environmental or developmental signals regulate its expression?
| Approach | Objective |
|---|---|
| CRISPR-Cas9 knockout | Assess root ion leakage phenotypes |
| Subcellular localization | Confirm membrane domain association |
| Yeast two-hybrid | Identify binding partners |
UniGene: Zm.102865
Zea mays CASP-like protein 15 belongs to a larger family of CASPL (CASP-like) proteins that share structural and potentially functional similarities with the characterized CASPARIAN STRIP MEMBRANE DOMAIN PROTEINS (CASP1-CASP5). Phylogenetic analyses have revealed that plant CASPL proteins show evolutionary conservation with the MARVEL protein family, with conserved residues primarily located in transmembrane domains . These transmembrane domains appear to be involved in CASP protein localization to specific membrane regions . Unlike animal caspases like CASP4, which are cysteine-aspartic acid proteases involved in apoptosis and inflammation , plant CASP-like proteins have evolved for specialized functions in membrane organization and cell wall modification. The specific CASP-like protein 15 in Zea mays (corn) likely emerged during the evolution of vascular plants, as the appearance of specialized structures like Casparian strips correlates with the emergence of CASP-specific signatures in plant genomes . Researchers studying this protein should be aware that it is annotated as CASP-like protein 4A1 (ZmCASPL4A1) in some databases, indicating its classification within a specific subfamily of CASP-like proteins .
While specific expression and localization data for Zea mays CASP-like protein 15 is limited in the provided search results, we can infer patterns based on related CASP proteins. CASP proteins typically show tissue-specific expression patterns that correspond to their functional roles in creating specialized membrane domains . In model plants, CASP proteins are predominantly expressed in tissues requiring barrier functions, such as the endodermis of roots where they contribute to the formation of Casparian strips . The protein sequence of Zea mays CASP-like protein 15 contains multiple transmembrane domains, suggesting its integration into cellular membranes . The amino acid sequence (MALQAQQQPTPSPTRDRVGSGEWLADTEKLPGAAASPEDVVVASTHHAAAAARYVPPRAT SHTAEPNPGRDGGGGWYSWNGARRARHDPPAPRRQQPAKTHPPAPPLPAAPPPPPPPPPA ASPAPAPRAPPPHAQVRSADRVVPAILSRKRRAAVMQRAALLARAAAAGXXLAALTVLAA DTRRGWARDSYSNYAQFRYSEAVNVVGFLYSVFQFVALAELMRRNTHLIPHPKRGLFDFT MDQVLAYLLISSSSSATARASDLTENWGSDSFPNMANGSIAISFVAFVVFAICSLISAYN LFRRDM) reveals features consistent with membrane localization, including hydrophobic regions that likely form transmembrane domains . Researchers should consider examining expression patterns across different developmental stages and in response to environmental stresses to fully characterize this protein's biological context.
Recombinant Zea mays CASP-like protein 15 is produced as a full-length protein comprising 306 amino acids with an N-terminal His-tag for purification purposes . The protein contains multiple hydrophobic regions consistent with its predicted role as a transmembrane protein that forms membrane domains . When expressed in E. coli systems, the recombinant protein can be purified to greater than 90% purity as determined by SDS-PAGE analysis . The amino acid sequence reveals potential functional domains, including transmembrane regions and possible interaction sites that may mediate protein-protein or protein-membrane associations . While detailed 3D structural data specific to this protein is not provided in the search results, approaches similar to those used in CASP (Critical Assessment of protein Structure Prediction) experiments could be employed to predict its three-dimensional structure . Researchers working with this protein should consider that, as a membrane protein, it may require specialized conditions for maintaining its native conformation during purification and subsequent experimental applications.
The optimal expression of recombinant Zea mays CASP-like protein 15 has been established in E. coli systems with the protein engineered to contain an N-terminal His-tag to facilitate purification . When designing expression systems, researchers should consider that as a membrane protein, CASP-like protein 15 may present challenges related to proper folding and solubility. The expression construct should be optimized with appropriate signal sequences and fusion tags that enhance membrane protein expression while maintaining native structure. For purification, affinity chromatography using the His-tag represents the primary method, followed by size exclusion chromatography to achieve the reported >90% purity . The purified protein is typically provided as a lyophilized powder, which should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, addition of 5-50% glycerol (with 50% being the default final concentration) and aliquoting for storage at -20°C/-80°C is recommended to maintain protein stability . Researchers should avoid repeated freeze-thaw cycles, which can compromise protein integrity, and working aliquots should be stored at 4°C for no more than one week .
Studying protein-protein interactions of membrane proteins like CASP-like protein 15 requires specialized approaches that maintain the membrane environment. Based on studies of related CASP proteins, researchers should consider co-immunoprecipitation assays adapted for membrane proteins, which may reveal interactions with peroxidases or other enzymes involved in cell wall modification . Yeast two-hybrid systems modified for membrane proteins (such as split-ubiquitin systems) can be employed to screen for potential interaction partners. Bimolecular fluorescence complementation (BiFC) represents another powerful in vivo approach, allowing visualization of protein interactions in plant cells. For in vitro studies, techniques such as microscale thermophoresis or surface plasmon resonance using reconstituted membrane environments can provide quantitative interaction data. Drawing from the functional analysis of other CASP proteins, researchers should focus on potential interactions with cell wall-modifying enzymes such as peroxidases, which have been shown to interact with CASP proteins to mediate lignin deposition in specialized cell wall domains . These interaction studies would help elucidate whether CASP-like protein 15 functions similarly to other CASP proteins in directing local cell wall modifications through protein-protein interactions.
Identification of specific membrane domains associated with CASP-like protein 15 requires multi-faceted approaches combining microscopy, biochemical fractionation, and functional assays. High-resolution confocal microscopy using fluorescently-tagged CASP-like protein 15 can reveal its spatial distribution within cellular membranes, while super-resolution techniques such as STORM or PALM can provide nanoscale resolution of membrane domain organization. Membrane fractionation using detergent resistance methods or density gradient centrifugation can isolate membrane microdomains for proteomic analysis. Drawing from studies of other CASP proteins, researchers should evaluate whether CASP-like protein 15 forms stable membrane domains with low protein turnover, similar to the Casparian strip membrane domain (CSD) formed by other CASP proteins . Diffusion barrier assays, using fluorescent lipophilic molecules or membrane proteins with different trafficking patterns, can determine if CASP-like protein 15 domains create functional membrane fences that restrict lateral diffusion . Complementary approaches might include proximity labeling techniques (BioID or APEX) to identify proteins in the vicinity of CASP-like protein 15 within membrane microdomains, potentially revealing the composition and organization of these specialized membrane regions.
Post-translational modifications (PTMs) likely play crucial roles in regulating CASP-like protein 15 localization, stability, and function, though specific modifications are not detailed in the search results. Researchers should investigate potential phosphorylation sites that might regulate membrane targeting or protein-protein interactions, particularly in the context of signaling pathways that respond to environmental stresses. Mass spectrometry-based proteomic approaches represent the gold standard for comprehensive identification of PTMs, allowing researchers to map specific modification sites within the CASP-like protein 15 sequence. Site-directed mutagenesis of predicted modification sites can establish their functional significance through comparison of mutant and wild-type protein behavior in localization or interaction assays. Based on studies of membrane proteins, researchers should also consider lipid modifications that might anchor CASP-like protein 15 to specific membrane regions or facilitate interactions with membrane lipids. Glycosylation might also affect protein folding or trafficking, though this would be more relevant in eukaryotic expression systems than the E. coli system typically used for recombinant production . Understanding the PTM landscape of CASP-like protein 15 would provide crucial insights into mechanisms regulating its assembly into specialized membrane domains.
When designing experiments to study CASP-like protein 15 function in vivo, researchers must implement comprehensive controls to ensure valid interpretation of results. Genetic controls should include knockout/knockdown lines of CASP-like protein 15, complementation lines expressing the wild-type protein in knockout backgrounds, and overexpression lines to assess gain-of-function effects. Expression of mutated versions of CASP-like protein 15 (e.g., with altered transmembrane domains) can help dissect structure-function relationships. Tissue-specific or inducible expression systems provide temporal and spatial control for studying dynamic processes. When using tagged versions of the protein (e.g., fluorescent or epitope tags), researchers should verify that the tag does not interfere with protein localization or function through comparison with untagged protein behaviors. Environmental controls must account for conditions that might affect CASP-like protein expression or function, including developmental stage, tissue type, and responses to abiotic or biotic stresses. For microscopy studies, appropriate markers for cellular compartments (e.g., plasma membrane, endoplasmic reticulum) should be included to confirm subcellular localization. When assessing barrier functions potentially mediated by CASP-like protein 15, permeability assays with appropriate tracers should include positive and negative control tissues with known barrier properties.
Validation of membrane domain formation by CASP-like protein 15 requires multiple complementary approaches that address both structural organization and functional consequences. Fluorescence recovery after photobleaching (FRAP) represents a powerful technique to assess protein mobility within membranes, potentially revealing the low turnover characteristic of proteins in specialized membrane domains, as observed with other CASP proteins . Heterologous expression systems, where CASP-like protein 15 is expressed in tissues that normally lack this protein, can demonstrate its intrinsic capacity to form membrane domains independent of tissue-specific factors. Drawing from studies of related CASP proteins, researchers should test whether CASP-like protein 15 can recruit cell wall-modifying enzymes to specific membrane regions, as this recruitment activity represents a key functional aspect of membrane domain formation . Electron microscopy techniques, including immunogold labeling, can provide high-resolution visualization of protein clustering within membrane regions. Biochemical approaches such as cross-linking followed by mass spectrometry can identify molecular proximities that reflect domain organization. Functional validation might include testing whether expression of CASP-like protein 15 creates diffusion barriers that restrict movement of membrane components between different membrane regions, similar to the barrier function demonstrated for other CASP proteins in the endodermis .
Investigating the role of CASP-like protein 15 in cell wall modification requires approaches that connect membrane domain formation with extracellular structural changes. Based on studies of related CASP proteins, researchers should examine potential interactions between CASP-like protein 15 and cell wall-modifying enzymes such as peroxidases, which have been implicated in lignin deposition directed by CASP proteins . Histochemical staining for specific cell wall components (e.g., lignin, suberin) in wild-type versus knockout/knockdown plants can reveal altered patterns that correlate with CASP-like protein 15 expression. Immunolocalization of cell wall components, combined with localization of CASP-like protein 15, can demonstrate spatial relationships between intracellular protein domains and extracellular modifications. Biochemical analysis of cell wall composition using techniques such as pyrolysis-GC/MS or FTIR spectroscopy can quantify changes in specific cell wall polymers associated with CASP-like protein 15 activity. For real-time monitoring of cell wall modifications, researchers might develop biosensors that detect specific enzymatic activities or polymer formation at the cell surface. The functional significance of these modifications can be assessed through permeability assays, mechanical testing, or pathogen challenge experiments that evaluate barrier properties potentially mediated by CASP-like protein 15-directed cell wall modifications.
Creating and validating CASP-like protein 15 knockouts in Zea mays requires strategic application of genome editing technologies combined with comprehensive validation approaches. CRISPR-Cas9 represents the most efficient approach for generating targeted knockouts, with guide RNAs designed to target conserved regions of the CASP-like protein 15 gene, particularly transmembrane domains critical for function. Researchers should design multiple guide RNAs targeting different regions to increase editing efficiency and provide options if certain regions prove difficult to edit. For validation at the DNA level, targeted sequencing of the edited regions represents the gold standard, while PCR-based genotyping can provide rapid screening of putative edited lines. Transcript analysis using RT-qPCR confirms knockdown at the mRNA level, while Western blotting with specific antibodies validates protein elimination. Functional validation should include phenotypic analysis focused on tissues where CASP-like protein 15 is normally expressed, examining potential alterations in membrane domain formation, cell wall composition, or barrier functions. Complementation experiments, where the wild-type CASP-like protein 15 is reintroduced into knockout lines, represent crucial controls to confirm that observed phenotypes result specifically from loss of this protein rather than off-target effects. For deeper functional analysis, researchers might consider creating conditional knockouts using tissue-specific or inducible CRISPR systems, particularly if complete knockouts prove lethal.
Interpreting evolutionary conservation patterns of CASP-like protein 15 requires sophisticated phylogenetic analyses that consider both sequence and functional relationships across species. Researchers should align CASP-like protein 15 sequences from diverse plant species, focusing particularly on transmembrane domains where conserved residues are typically located . Identification of CASP-specific signatures, such as the EL1 stretch found in some CASP proteins, can provide insights into functional specialization within the broader CASPL family . The evolutionary relationship between plant CASP proteins and MARVEL proteins should be considered when interpreting conservation patterns, as this relationship may reflect fundamental structural features important for membrane domain formation . Mapping conserved residues onto predicted three-dimensional structures can reveal clustering patterns that suggest functional importance. Researchers should distinguish between general conservation patterns common to all CASPL proteins and specific conservation patterns unique to the CASP-like protein 15 subfamily, as these distinctions may correlate with functional divergence. Analysis of selection pressure (dN/dS ratios) across different regions of the protein can identify domains under positive or purifying selection, providing insights into evolutionary constraints. Correlation between the presence of specific CASP variants and specialized plant structures (such as Casparian strips) can reveal functional adaptations during plant evolution .
Predicting functional domains in CASP-like protein 15 requires integration of multiple bioinformatic approaches that consider sequence, structure, and evolutionary information. Transmembrane topology prediction tools such as TMHMM, Phobius, or TOPCONS should be employed to identify membrane-spanning regions, which are critical for CASP protein function and typically contain conserved residues . Secondary structure prediction using PSIPRED or JPred can identify structural motifs within both transmembrane and soluble domains. Multiple sequence alignment of CASP-like protein 15 with other CASPL family members can reveal conserved regions likely to have functional importance, particularly when conservation patterns are mapped onto predicted structural features. Motif detection algorithms can identify short sequence patterns associated with specific functions, such as protein-protein interaction sites or post-translational modification motifs. Based on findings from other CASP proteins, researchers should pay particular attention to regions that might mediate interactions with cell wall-modifying enzymes or create membrane scaffolds . For three-dimensional structure prediction, approaches similar to those used in CASP (Critical Assessment of protein Structure Prediction) competitions can generate structural models that provide insights into spatial relationships between functional domains . Integrating these predictions with experimental data, such as the effects of targeted mutations on protein localization or function, represents the most robust approach for validating bioinformatically predicted functional domains.
Resolving contradictory findings regarding CASP-like protein functions requires systematic evaluation of methodological differences, biological context variations, and potential technical artifacts across studies. Researchers should first conduct detailed comparative analysis of experimental conditions, including expression systems, purification methods, and functional assays, as these factors can significantly influence observed protein behaviors. Species-specific differences must be considered, as CASP-like proteins may have evolved specialized functions in different plant lineages despite sequence similarity. Experimental validation using multiple complementary approaches provides stronger evidence than single-method studies and can help reconcile contradictory findings. Meta-analysis of published data, with careful attention to statistical power and effect sizes, can identify robust findings versus potentially spurious results. For membrane proteins like CASP-like protein 15, contradictions may arise from differences in membrane environments or detergent conditions used during purification and analysis . Structural studies using techniques such as those employed in CASP competitions can provide molecular-level insights that explain apparently contradictory functional observations . Collaborative approaches, where different research groups apply standardized protocols to the same biological questions, represent powerful strategies for resolving persistent contradictions. Publication of detailed methods, including potential limitations and negative results, contributes significantly to resolving contradictions in the scientific literature.
Analyzing localization patterns of CASP-like protein 15 requires sophisticated statistical approaches that account for the spatial nature of the data and potential biological variability. Quantitative image analysis should begin with standardized preprocessing steps, including background subtraction, bleaching correction, and normalization, to ensure comparable measurements across samples. Colocalization analysis using Pearson's correlation coefficient or Manders' overlap coefficient can quantify association between CASP-like protein 15 and markers for specific cellular compartments or other proteins of interest. For temporal dynamics, statistical approaches that account for time-series autocorrelation, such as autoregressive integrated moving average (ARIMA) models, provide more robust analysis than simple comparisons of individual timepoints. When analyzing membrane domain formation, spatial statistics such as Ripley's K-function can quantify the degree of protein clustering beyond random distribution. Mixed-effects models represent powerful approaches for experiments with multiple sources of variation (e.g., different plants, tissues, or cells), allowing researchers to account for biological variability while testing specific hypotheses about CASP-like protein 15 localization. For high-throughput imaging data, machine learning approaches can identify complex localization patterns that might not be apparent with traditional statistical methods. Power analysis during experimental design ensures sufficient replication to detect biologically meaningful differences in localization patterns, particularly important when studying potentially subtle effects of experimental manipulations on CASP-like protein 15 distribution.