Recombinant Zea mays CASP-like protein 16

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchasing method or location. We recommend consulting your local distributor for precise delivery information.
Please note that all our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain product integrity, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
CASP-like protein 4U1; ZmCASPL4U1; Vegetative cell wall protein gp1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-369
Protein Length
full length protein
Species
Zea mays (Maize)
Target Protein Sequence
MASTPRTPAPERSPPPVPTPPPPLEDEPPPYLADGSPREEASFSSDGREGAPPKNPQLSP THHAAPRLVPPPSSPARQDGQEQEGSANKAAAATAEPAREPLRQMATGLARPLSSQTSPA TTNSPTPSASPTPSSPAPVANNSKRSGQSTPKRAETKLPLSSPAVAVHFDPVEEAVTSPL RLGKARLDQQQQQQHAAGAAESGASVVPGVAAAVAAVAERRELLLALRLATAVLSLAAFS VIASARTSGWAGDYYARHLQYRYAVAVNVIVFAYSVAQSLGKIRHLVSPRFTFRTMSSYY CSLFLDQVLAYLLMSASSAAASRNDLWVSRFGTDAFVRKITGALWLSFVAFLVLALNAVI SXANLFSMV
Uniprot No.

Target Background

Database Links

KEGG: zma:100285933

UniGene: Zm.101395

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ZmCASPL16 and where is it located in the maize genome?

ZmCASPL16 is a member of the Casparian strip membrane domain protein-like (CASPL) family in Zea mays (maize). The CASPL gene family consists of 47 members that have been identified at the whole-genome level and systematically classified into six distinct groups . ZmCASPL16 is one of the simpler members in terms of gene structure, containing only one exon compared to the majority of ZmCASPL genes that contain three exons . Its distinct physical structure suggests specialized functionality within the broader CASPL family.

How does ZmCASPL16 differ from other members of the ZmCASPL family?

ZmCASPL16 exhibits several distinctive characteristics compared to other ZmCASPL proteins:

  • Unlike most ZmCASPL proteins that are hydrophobic (having a grand average of hydropathicity greater than zero), ZmCASPL16 has a hydropathicity value less than zero, making it hydrophilic .

  • It possesses a simpler gene structure with only one exon, while approximately 57.45% of ZmCASPL genes contain three exons .

  • Like other CASPL proteins, ZmCASPL16 is likely a four-transmembrane span protein that may function in membrane domain formation, similar to other CASPL proteins that can integrate into CASP membrane domains when expressed ectopically .

What are the predicted functional domains in ZmCASPL16?

ZmCASPL16 likely contains domains similar to other CASPL family members. The majority (72%) of ZmCASPL proteins contain CASP domains responsible for membrane interactions . Based on homology studies, CASPL proteins share similarity with MARVEL domain proteins, with conserved regions particularly in the transmembrane domains . These domains are critical for the protein's function in potentially forming membrane scaffolds and directing cell wall modifications. The conservation of transmembrane domains rather than extracellular or intracellular regions is a key feature shared with MARVEL domain proteins .

What expression patterns does ZmCASPL16 exhibit in different tissues?

While the search results don't provide tissue-specific expression data for ZmCASPL16 specifically, RNA-seq analysis of the ZmCASPL family revealed distinctive expression patterns for different members. Some ZmCASPL genes (specifically noted were ZmCASPL21 and ZmCASPL47) show high expression specifically in roots, suggesting involvement in Casparian strip development . A comprehensive expression analysis across tissues would be necessary to determine ZmCASPL16's specific expression pattern, which could provide insights into its biological function.

What protocols are recommended for recombinant expression of ZmCASPL16?

For recombinant expression of ZmCASPL16, researchers should consider the following methodological approach:

  • Gene synthesis or cloning: Since ZmCASPL16 contains only one exon , it may be suitable for direct PCR amplification from genomic DNA, followed by cloning into an appropriate expression vector.

  • Expression system selection: Consider the hydrophilic nature of ZmCASPL16 (hydropathicity value < 0) when selecting an expression system. For membrane proteins:

    • Bacterial systems (E. coli) may be suitable for initial trials

    • Eukaryotic systems (yeast, insect cells) may provide better folding for functional studies

    • Plant-based expression systems could maintain native post-translational modifications

  • Purification strategy: Design a purification scheme considering:

    • Fusion tags (His, GST, MBP) that won't interfere with transmembrane domains

    • Detergent selection for membrane protein solubilization

    • Maintaining protein stability during extraction

  • Validation: Verify protein identity through mass spectrometry and functional assays relevant to membrane localization and scaffold formation capabilities.

How can researchers investigate ZmCASPL16's role in abiotic stress response?

To investigate ZmCASPL16's potential role in abiotic stress responses:

  • Expression analysis under stress conditions: RT-qPCR analysis similar to that performed for ZmCASPL5/13/25/44 under PEG (drought simulation) and NaCl (salt stress) treatments . Design experiments including:

    • Time-course analysis (early, intermediate, late responses)

    • Dose-dependent responses to stressors

    • Multiple stress types (drought, salt, heat, cold, nutrient deficiency)

  • Transgenic approaches:

    • Overexpression studies to assess enhanced stress tolerance

    • CRISPR/Cas9 knockouts or RNAi silencing to evaluate loss-of-function phenotypes

    • Promoter-reporter fusions to visualize spatiotemporal expression patterns under stress

  • Protein interaction studies:

    • Yeast two-hybrid or co-immunoprecipitation to identify stress-responsive interaction partners

    • BiFC (Bimolecular Fluorescence Complementation) for in vivo interaction visualization

  • Physiological measurements: Compare wild-type and transgenic lines for differences in:

    • Root hydraulic conductivity

    • Ion content in shoots and roots

    • Reactive oxygen species accumulation

    • Membrane integrity under stress conditions

What approaches can be used to study ZmCASPL16 involvement in Casparian strip formation?

Investigating ZmCASPL16's potential role in Casparian strip formation requires specialized techniques:

  • Localization studies:

    • Generate fluorescent protein fusions to determine subcellular localization

    • Immunolocalization with specific antibodies against ZmCASPL16

    • Co-localization with known Casparian strip markers

  • Functional analysis:

    • Heterologous expression in Arabidopsis endodermis to assess integration into the CASP membrane domain, as observed with other CASPL proteins

    • Assess protein mobility in the membrane using FRAP (Fluorescence Recovery After Photobleaching)

    • Examine ability to form protein scaffolds and recruit enzymes involved in lignin polymerization

  • Cell wall analysis:

    • Histochemical staining for Casparian strip development

    • Analysis of lignin composition and deposition patterns

    • Barrier function tests using tracer molecules

  • Protein-protein interactions:

    • Investigate interactions with known Casparian strip regulatory proteins like MYB36 transcription factors

    • Examine associations with enzymes involved in lignin polymerization (RBOHF, ESB1, PER64, UCC1)

How can researchers analyze the evolutionary conservation of ZmCASPL16?

To analyze evolutionary conservation of ZmCASPL16:

  • Phylogenetic analysis:

    • Construct comprehensive phylogenetic trees including:

      • All 47 ZmCASPL family members

      • CASPL proteins from other plant species

      • MARVEL domain proteins from outside the plant kingdom

    • Identify closest homologs across species and evaluate functional equivalence

  • Comparative genomics:

    • Analyze syntenic regions across related grass species

    • Examine selection pressure using Ka/Ks ratios

    • Identify conserved non-coding sequences that might regulate expression

  • Structural conservation assessment:

    • Predict protein structure using homology modeling

    • Identify conserved motifs, particularly in transmembrane domains

    • Compare with known CASPL proteins that have established functions

  • Functional complementation:

    • Test if ZmCASPL16 can complement mutants of orthologous genes in other species

    • Express orthologs from other species in maize and assess functionality

What methods are effective for analyzing ZmCASPL16 membrane integration and scaffold formation?

Analyzing ZmCASPL16's membrane integration and scaffold formation requires specialized techniques:

  • Membrane protein topology determination:

    • Protease protection assays to identify exposed regions

    • Substituted cysteine accessibility method (SCAM) to map transmembrane domains

    • Glycosylation site insertion to determine lumenal domains

  • Membrane domain analysis:

    • Detergent resistance assays to assess incorporation into membrane microdomains

    • Single-molecule tracking to monitor protein dynamics within the membrane

    • FRET analysis to measure proximity to other membrane components

    • Super-resolution microscopy (STORM, PALM) to visualize nanoscale organization

  • Scaffold formation assessment:

    • Analysis of protein oligomerization state using:

      • Native PAGE

      • Chemical crosslinking

      • Analytical ultracentrifugation

    • In vitro reconstitution in liposomes or nanodiscs to assess scaffold-forming properties

  • Functional domain mapping:

    • Generate deletion constructs to identify regions essential for scaffold formation

    • Site-directed mutagenesis of conserved residues in transmembrane domains

    • Chimeric protein construction with other CASPL members to identify specificity determinants

How can researchers investigate potential roles of ZmCASPL16 in mineral nutrient uptake?

To investigate ZmCASPL16's potential role in mineral nutrient uptake:

  • Physiological characterization:

    • Compare mineral content (ICP-MS analysis) in wild-type vs. ZmCASPL16-modified plants

    • Trace radioisotope uptake and translocation studies

    • Analyze root-to-shoot transport efficiency for different nutrients

  • Imaging techniques:

    • Use fluorescent nutrient analogs to track uptake patterns

    • Synchrotron X-ray fluorescence microscopy for in situ mineral localization

    • Cryo-SEM with energy-dispersive X-ray spectroscopy for cellular mineral distribution

  • Transporter interaction studies:

    • Investigate physical interactions with known nutrient transporters

    • Assess colocalization patterns with transport proteins

    • Measure transporter activity in the presence/absence of functional ZmCASPL16

  • Regulatory network analysis:

    • Examine transcriptional responses to nutrient deficiency

    • Assess hormonal regulation of ZmCASPL16 expression under varying nutrient conditions

    • Investigate promoter elements responsive to nutrient availability

What techniques can be used to characterize the interactome of ZmCASPL16?

For comprehensive characterization of the ZmCASPL16 interactome:

  • Protein-protein interaction screening:

    • Yeast two-hybrid screening against root/endodermis cDNA libraries

    • Co-immunoprecipitation coupled with mass spectrometry (Co-IP-MS)

    • Proximity-dependent biotin identification (BioID) or APEX2 proximity labeling

    • Split-ubiquitin system for membrane protein interactions

  • Validation of interactions:

    • Bimolecular Fluorescence Complementation (BiFC) in planta

    • Förster Resonance Energy Transfer (FRET) for direct interaction assessment

    • Pull-down assays with recombinant proteins

    • Surface Plasmon Resonance (SPR) for interaction kinetics

  • Functional relevance assessment:

    • Co-expression analysis under various conditions

    • Mutational analysis of interaction interfaces

    • Competition assays with predicted binding partners

    • Phenotypic analysis of double mutants

  • Dynamic interactome mapping:

    • Temporal analysis of interactions during development

    • Stress-induced changes in the interactome

    • Tissue-specific interaction networks

    • Post-translational modification-dependent interactions

How should researchers design experiments to assess ZmCASPL16 function in response to multiple stresses?

For robust experimental designs investigating ZmCASPL16 function under multiple stresses:

  • Experimental system setup:

    • Use multiple genetic backgrounds (inbred lines, hybrids)

    • Include appropriate controls (wild-type, empty vector, other CASPL knockouts)

    • Implement factorial designs to test interactions between stresses

    • Use gradient stress levels to identify threshold responses

  • Stress application protocols:

    • Drought: Controlled soil moisture deficit using gravimetric methods, PEG treatment for seedlings

    • Salt stress: Defined NaCl concentrations applied to hydroponic or soil systems

    • Temperature stress: Precise temperature control with monitoring of plant tissue temperatures

    • Nutrient stress: Defined nutrient solution formulations with specific element limitations

    • Combined stresses: Sequential or simultaneous application with appropriate controls

  • Comprehensive phenotyping:

    • Growth parameters (biomass, root architecture, leaf area)

    • Physiological measurements (photosynthetic efficiency, stomatal conductance)

    • Biochemical markers (proline, malondialdehyde, antioxidant enzymes)

    • Molecular phenotyping (transcriptome, proteome, metabolome)

  • Temporal considerations:

    • Include multiple time points to capture early, intermediate, and late responses

    • Consider developmental stage effects on stress responses

    • Monitor recovery phases after stress relief

What considerations are important when optimizing expression and purification of recombinant ZmCASPL16?

Key considerations for optimizing expression and purification of recombinant ZmCASPL16:

  • Codon optimization:

    • Adapt codons for the expression system of choice

    • Consider rare codon analysis and tRNA supplementation

    • Optimize GC content and avoid secondary structures in mRNA

  • Expression construct design:

    • Select appropriate fusion tags considering ZmCASPL16's hydrophilic nature

    • Include protease cleavage sites for tag removal

    • Consider signal peptides for membrane targeting

    • Add stabilizing domains if necessary

  • Expression conditions optimization:

    • Test multiple induction methods (temperature, inducer concentration)

    • Optimize growth media composition

    • Evaluate expression timing (early vs. late induction)

    • Consider reduced temperature expression for membrane proteins

  • Purification strategy development:

    • Select appropriate detergents based on critical micelle concentration

    • Consider membrane-mimetic systems (nanodiscs, amphipols)

    • Implement multiple purification steps (affinity, ion exchange, size exclusion)

    • Validate protein folding and homogeneity at each step

How can researchers effectively design CRISPR/Cas9 targeting strategies for ZmCASPL16 functional studies?

Effective CRISPR/Cas9 targeting strategies for ZmCASPL16 functional studies:

  • Target site selection:

    • Design sgRNAs targeting the single exon of ZmCASPL16

    • Prioritize sites in early coding regions to ensure loss-of-function

    • Target conserved domains critical for function

    • Consider multiplex targeting to ensure complete knockout

  • Off-target minimization:

    • Conduct thorough off-target prediction specific to the maize genome

    • Consider potential effects on other ZmCASPL family members

    • Design validation strategies to confirm specificity

    • Use high-fidelity Cas9 variants to reduce off-target effects

  • Editing strategy options:

    • Standard knockout via NHEJ (non-homologous end joining)

    • Precise modifications using HDR (homology-directed repair)

    • Base editing for specific amino acid changes

    • Prime editing for precise insertions or deletions

  • Validation pipeline:

    • PCR-based genotyping strategies

    • Sequencing confirmation of edits

    • RT-qPCR to confirm expression changes

    • Western blotting to verify protein absence/modification

    • Phenotypic characterization under multiple conditions

How should researchers approach comparative analysis of ZmCASPL16 with other CASPL family proteins?

A systematic approach to comparative analysis of ZmCASPL16 with other CASPL proteins:

  • Sequence-based comparisons:

    • Multiple sequence alignment of all 47 ZmCASPL proteins

    • Identify conserved motifs specific to functional groups

    • Calculate similarity/identity percentages between family members

    • Map ZmCASPL16's position within the six distinct CASPL groups

  • Structural comparison approaches:

    • Predict secondary and tertiary structures of multiple CASPL proteins

    • Compare transmembrane domain arrangements

    • Analyze conservation of functionally important residues

    • Calculate root-mean-square deviation (RMSD) between predicted structures

  • Expression pattern analysis:

    • Compare tissue-specific expression profiles across family members

    • Analyze stress-responsive expression patterns

    • Identify co-expressed CASPL genes

    • Calculate correlation coefficients between expression patterns

  • Functional domain comparison:

    • Map domain architecture differences between family members

    • Compare protein interaction surfaces

    • Analyze differences in subcellular targeting sequences

    • Evaluate conservation of post-translational modification sites

What statistical approaches are appropriate for analyzing ZmCASPL16 expression under various stress conditions?

Appropriate statistical approaches for analyzing ZmCASPL16 expression under stress conditions:

  • Experimental design considerations:

    • Use appropriate biological and technical replicates (minimum n=3)

    • Include time-matched controls for all treatments

    • Consider factorial designs to test interaction effects

    • Implement time-course analysis for temporal patterns

  • Normalization methods:

    • Select stable reference genes validated under stress conditions

    • Consider multiple reference gene normalization (geometric mean approach)

    • Evaluate need for between-sample normalization

    • Assess technical variation through control samples

  • Statistical tests selection:

    • ANOVA with post-hoc tests for multiple treatment comparisons

    • Linear mixed models for complex experimental designs

    • Time-series analysis for temporal expression patterns

    • Non-parametric alternatives when assumptions are violated

  • Advanced analytical approaches:

    • Principal component analysis for multivariate stress responses

    • Cluster analysis to identify co-regulated genes

    • Network analysis to position ZmCASPL16 in stress response networks

    • Machine learning approaches for predictive modeling

How can researchers integrate transcriptomic and proteomic data to understand ZmCASPL16 function?

Strategies for integrating transcriptomic and proteomic data in ZmCASPL16 research:

  • Data collection coordination:

    • Collect samples from identical tissues/conditions/time points

    • Process paired samples to minimize technical variation

    • Include appropriate normalization controls

    • Consider subcellular fractionation for membrane protein enrichment

  • Analysis workflow:

    • Normalize and analyze datasets independently first

    • Map transcript to protein relationships

    • Calculate correlation between transcript and protein abundance

    • Identify post-transcriptional regulatory effects

  • Integration methods:

    • Pathway enrichment analysis using both datasets

    • Network reconstruction incorporating both data types

    • Identification of transcriptional and post-transcriptional regulation

    • Multi-omics factor analysis for dimension reduction

  • Functional interpretation:

    • Identify discordant transcript-protein pairs as potential regulatory targets

    • Analyze membrane protein complex composition changes

    • Integrate with protein interaction data to build functional networks

    • Develop hypotheses about ZmCASPL16 regulation at multiple levels

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.