Recombinant Zea mays CASP-like protein 3

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this to us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
CASP-like protein 1D1; ZmCASPL1D1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Zea mays (Maize)
Target Protein Sequence
MATVDATTTAGSGKQTDAAPSPPAAAAAACRSLSGADLALRVLLFAVTLSGLVVLATAEQ TVRVPVPQIPGLVLSLPAKFKDSPALIYLLVALCVTCFYSLLSTAFTSLKLLFGSSPSRT LFLLVLFDVFYAAIMASATGSAGGVAWIGLKGNSHTNWNKICNIYGKFCRHIGSSVFLGL IASVVLVLLTILNAHSLYRRSR
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are Zea mays CASP-like proteins and what is their general function in maize?

Zea mays CASP-like proteins (ZmCASPLs) belong to a family of transmembrane proteins that share considerable homology with Casparian Strip Membrane Domain Proteins (CASPs). These proteins are characterized by a distinctive architecture comprising four transmembrane domains, two intracellular loops, one extracellular loop, as well as N-terminal and C-terminal residues. ZmCASPLs exhibit significant structural similarity to proteins possessing the MARVEL domain, with particularly conserved sequences in the first (TM1) and third (TM3) transmembrane domains .

Functionally, ZmCASPL proteins are associated with root development, stress responsiveness, and mineral element uptake in plants. In particular, certain ZmCASPL members appear to be involved in the development of the Casparian strip, a specialized cell wall modification in the root endodermis that regulates the selective absorption of water and nutrients . The presence of MYB-binding sites (CAACCA) in most ZmCASPL genes further supports their involvement in Casparian strip development, as these binding sites are associated with Casparian strip formation .

How many ZmCASPL genes have been identified in the maize genome and how are they classified?

Comprehensive genome-wide analysis has identified 47 ZmCASPL members in the maize genome. These genes have been systematically classified into six distinct phylogenetic groups based on their sequence homology and evolutionary relationships . This classification system helps researchers understand the functional diversification and evolutionary history of the ZmCASPL gene family.

The classification is particularly important for comparative genomics studies across different plant species. For instance, ZmCASPL32 and ZmCASPL42 show close evolutionary relationships with AtCASP1 from Arabidopsis, suggesting these two maize genes might share functional roles in endodermal Casparian strip development and selective absorption of mineral elements .

What domains and structural features characterize ZmCASPL proteins?

ZmCASPL proteins display several characteristic domains and structural features:

  • A significant majority (72%) of ZmCASPL proteins contain CASP domains, which are essential for their function in Casparian strip formation.

  • Eight ZmCASPL proteins (ZmCASPL5, ZmCASPL8, ZmCASPL10, ZmCASPL13, ZmCASPL32, ZmCASPL35, ZmCASPL39, and ZmCASPL47) contain MARVEL domains instead of CASP domains .

  • ZmCASPL17 exhibits a unique structure with two domains in series: CASP and PHA00427 .

  • Most ZmCASPL genes (57.45%) contain three exons, though some variation exists. For example, ZmCASPL1, ZmCASPL7, ZmCASPL16, ZmCASPL19, ZmCASPL24, and ZmCASPL38 contain only one exon, while ZmCASPL36 has six exons .

This structural diversity suggests functional specialization among different ZmCASPL proteins, which may explain their varied roles in maize development and stress responses.

Which ZmCASPL genes show tissue-specific expression patterns?

RNA-seq analysis has revealed significant tissue-specific expression patterns among ZmCASPL genes. Most notably, ZmCASPL21 and ZmCASPL47 demonstrate high expression specifically in root tissues, suggesting their involvement in root-specific processes, particularly Casparian strip development . This tissue-specific expression pattern provides valuable insights for researchers targeting specific ZmCASPL proteins for functional characterization.

When designing experiments to study recombinant ZmCASPL3 or other family members, researchers should consider the native expression patterns to inform their experimental design. For root-expressed ZmCASPL proteins, root-derived cell lines or root explant cultures may provide more physiologically relevant expression systems than other tissue types.

How do environmental stresses affect the expression of ZmCASPL genes?

RNA-seq analysis has demonstrated that ZmCASPL genes exhibit distinct expression responses to various environmental stresses. Specifically, drought, salt, heat, cold stresses, low nitrogen and phosphorus conditions, and pathogen infection significantly impact the expression patterns of ZmCASPL genes .

Quantitative RT-PCR experiments have confirmed differential expression patterns for several ZmCASPL genes, including ZmCASPL5, ZmCASPL13, ZmCASPL25, and ZmCASPL44, under polyethylene glycol (PEG) and sodium chloride (NaCl) treatments, which simulate drought and salt stress conditions, respectively . These findings suggest that ZmCASPL proteins play important roles in maize stress response mechanisms.

For researchers working with recombinant ZmCASPL3, considering these stress-responsive expression patterns may be valuable for designing functional assays that evaluate the protein's role under specific stress conditions.

What expression systems are most suitable for producing recombinant ZmCASPL proteins?

When selecting an expression system for recombinant ZmCASPL proteins, researchers should consider the following factors based on established protocols for similar proteins:

  • Bacterial expression systems: While E. coli systems are commonly used for recombinant protein production, membrane proteins like ZmCASPLs may require specialized strains. The proper folding of transmembrane domains is critical for functional studies. Based on protocols for similar proteins, BL21(DE3) or Rosetta™ strains with specialized vectors containing solubility tags (such as MBP, GST, or SUMO) may improve expression and solubility.

  • Eukaryotic expression systems: For functional studies requiring proper post-translational modifications, yeast (Pichia pastoris or Saccharomyces cerevisiae), insect cells (Sf9 or Sf21), or plant expression systems may be more appropriate. Plant-based expression systems, particularly tobacco or maize cell cultures, might provide the most native environment for proper folding and modification of ZmCASPL proteins.

The choice should be guided by the specific research objectives. For structural studies, high-yield systems may be prioritized, while for functional analyses, systems that maintain native protein conformation should be considered.

What purification strategies are most effective for recombinant ZmCASPL proteins?

Purifying recombinant ZmCASPL proteins presents challenges due to their multiple transmembrane domains. Based on established protocols for membrane proteins:

  • Solubilization: Careful selection of detergents is crucial. Mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin are often effective for maintaining protein structure while extracting from membranes.

  • Affinity chromatography: His-tagged or FLAG-tagged constructs can facilitate purification using immobilized metal affinity chromatography (IMAC) or anti-FLAG affinity resins, respectively.

  • Size exclusion chromatography: As a final purification step, size exclusion chromatography can separate properly folded protein from aggregates and improve sample homogeneity.

  • Stability considerations: Incorporation of stabilizing agents such as glycerol (10-20%) and reducing agents (DTT or β-mercaptoethanol) in buffers can improve protein stability, similar to formulations used for other recombinant proteins .

The purification protocol should be optimized based on the specific ZmCASPL protein and its intended use, with particular attention to maintaining the native conformation of transmembrane domains.

How can proteomics resources like the Maize PeptideAtlas be leveraged to study ZmCASPL proteins?

The Maize PeptideAtlas (www.peptideatlas.org/builds/maize) represents a valuable resource for researchers studying ZmCASPL proteins. This comprehensive database contains reanalyzed tandem mass spectrometry (MS/MS) data from various maize genetic backgrounds, including inbred lines B73 and W22, and numerous hybrids .

Researchers can utilize this resource to:

  • Verify protein expression: Confirm the expression of specific ZmCASPL proteins across different tissues, developmental stages, and environmental conditions.

  • Identify post-translational modifications: The PeptideAtlas includes data on N-terminal acetylation, phosphorylation, ubiquitination, and lysine acylations that can be inspected through a PTM viewer .

  • Compare protein isoforms: The database includes proteins identified from multiple genome annotations (B73 v3, v4, v5, W22, and others), allowing researchers to investigate potential isoforms or annotation differences of ZmCASPL proteins .

  • Design targeted proteomics assays: The spectral data can guide the development of targeted proteomics assays for quantitative analysis of specific ZmCASPL proteins.

When using the Maize PeptideAtlas for ZmCASPL research, researchers should note that the resource contains 445 million MS/MS spectra of which 120 million were matched to 0.37 million distinct peptides, covering 66.2% of the proteins in the most recent B73 nuclear genome annotation (v5) .

What strategies can be employed to study protein-protein interactions of ZmCASPL3?

Understanding the protein-protein interactions of ZmCASPL3 is crucial for elucidating its functional roles in maize. Several complementary approaches can be employed:

  • Yeast two-hybrid (Y2H) assays: While challenging for full-length membrane proteins, modified split-ubiquitin Y2H systems designed for membrane proteins can be effective. Alternatively, soluble domains of ZmCASPL3 can be used as baits in conventional Y2H screens.

  • Co-immunoprecipitation (Co-IP): Using epitope-tagged recombinant ZmCASPL3 expressed in plant cells, researchers can pull down protein complexes and identify interacting partners through mass spectrometry.

  • Bimolecular fluorescence complementation (BiFC): This in vivo technique can confirm direct interactions and provide information about the subcellular localization of the interaction.

  • Proximity-dependent biotin identification (BioID): Fusion of ZmCASPL3 with a biotin ligase can enable identification of proximal proteins in the native cellular environment, which is particularly valuable for membrane proteins.

  • Cross-linking mass spectrometry: Chemical cross-linking followed by MS analysis can capture transient or weak interactions in their native cellular context.

When analyzing ZmCASPL3 interactions, researchers should consider that based on knowledge of related proteins, ZmCASPL members likely interact with other membrane proteins involved in Casparian strip formation and may form homo- or hetero-oligomeric complexes .

What are the functional differences between ZmCASPL proteins with CASP domains versus those with MARVEL domains?

The functional distinctions between ZmCASPL proteins containing CASP domains versus those with MARVEL domains represent an important area for investigation. While comprehensive functional characterization is still emerging, several key differences can be inferred:

  • Subcellular localization: CASP domain-containing ZmCASPLs are likely concentrated at the Casparian strip domain in the endodermis, while MARVEL domain-containing members (including ZmCASPL5, ZmCASPL8, ZmCASPL32, ZmCASPL47, ZmCASPL10, ZmCASPL13, ZmCASPL35, and ZmCASPL39) may localize to different membrane compartments or cell types.

  • Protein scaffolding function: CASP domains typically function in protein scaffolding and organizing membrane microdomains. In contrast, MARVEL domains are often associated with membrane apposition and tight junction regulation in other systems.

  • Stress responses: Based on expression data, ZmCASPL proteins with different domains show distinct responses to environmental stresses, suggesting divergent functions in stress adaptation.

  • Evolutionary conservation: The domain distribution may reflect evolutionary history and functional diversification within the ZmCASPL family. Proteins with similar domain architecture likely share similar functions across species.

When designing functional studies of recombinant ZmCASPL3, researchers should determine which domain type it contains and consider comparative analyses with other family members containing similar domains.

What are common challenges in the production of functional recombinant ZmCASPL proteins?

Producing functional recombinant ZmCASPL proteins presents several technical challenges that researchers should anticipate:

  • Membrane protein solubility: As transmembrane proteins with four transmembrane domains, ZmCASPLs are prone to aggregation and misfolding when overexpressed. Using fusion partners like MBP or SUMO can improve solubility, as can expression at lower temperatures (16-20°C).

  • Proper folding: The correct folding of transmembrane domains is essential for function. Consideration of carrier proteins during purification, similar to those used for other recombinant proteins, may help maintain protein stability .

  • Post-translational modifications: If ZmCASPL3 requires specific post-translational modifications for function, expression systems that can perform these modifications should be selected.

  • Protein yield: Expression levels of membrane proteins are often lower than soluble proteins. Optimization of codon usage for the expression host and inclusion of appropriate signal sequences can improve yields.

  • Functional verification: Demonstrating that the recombinant protein retains native function can be challenging. Development of appropriate functional assays, potentially based on known functions of CASP proteins in Arabidopsis, is crucial.

When troubleshooting production issues, systematic optimization of expression conditions (temperature, inducer concentration, expression duration) and purification protocols (detergent selection, buffer composition) is recommended.

What methods are available for assessing the structural integrity of purified recombinant ZmCASPL proteins?

Verifying the structural integrity of purified recombinant ZmCASPL proteins is essential for ensuring that functional studies yield reliable results. Several complementary techniques can be employed:

  • Circular dichroism (CD) spectroscopy: Provides information about secondary structure content (α-helices, β-sheets) and can confirm proper folding. For transmembrane proteins like ZmCASPLs, which are expected to have high α-helical content, CD can be particularly informative.

  • Fluorescence spectroscopy: Intrinsic tryptophan fluorescence can indicate proper tertiary structure formation. Changes in emission spectra upon ligand binding can also provide functional validation.

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): Determines the oligomeric state and homogeneity of the purified protein, which is important as many membrane proteins function as oligomers.

  • Limited proteolysis: Properly folded proteins typically display distinct proteolytic patterns compared to misfolded variants. This approach can quickly assess structural integrity.

  • Thermal stability assays: Techniques like differential scanning fluorimetry (DSF) can measure protein stability and the effects of different buffer conditions, ligands, or mutations.

When storing purified ZmCASPL proteins, researchers should consider similar handling to other recombinant proteins, using manual defrost freezers and avoiding repeated freeze-thaw cycles to maintain stability and function .

How might genome editing technologies be applied to study ZmCASPL gene function in vivo?

CRISPR/Cas9 and other genome editing technologies offer powerful approaches for investigating ZmCASPL gene function directly in maize plants:

  • Gene knockout studies: Generation of ZmCASPL3 knockout lines using CRISPR/Cas9 can reveal its physiological role. Given the potential functional redundancy among ZmCASPL family members, as observed in Arabidopsis CASP mutants , multiple gene knockouts may be necessary to observe clear phenotypes.

  • Domain-specific modifications: Precise editing can target specific domains to understand their importance for protein function. For instance, modifying the transmembrane domains or protein interaction sites can reveal their functional significance.

  • Promoter modifications: Altering the promoter regions can provide insights into transcriptional regulation, particularly for stress-responsive elements.

  • Fluorescent protein tagging: Knock-in of fluorescent protein tags can facilitate visualization of native expression patterns and subcellular localization without overexpression artifacts.

  • Base editing approaches: More subtle modifications using base editors or prime editors can introduce specific mutations to test hypotheses about protein function or regulatory elements.

When designing genome editing experiments, researchers should consider the evolutionary relationships between ZmCASPL genes, as closely related members may have redundant functions that could mask phenotypic effects in single mutants .

What is the potential for using recombinant ZmCASPL proteins in agricultural applications?

While current research on ZmCASPL proteins is primarily fundamental, several potential agricultural applications merit investigation:

  • Improved nutrient uptake efficiency: Given the role of CASP proteins in forming Casparian strips that regulate nutrient uptake, engineered ZmCASPL variants could potentially improve nutrient use efficiency in crops.

  • Enhanced stress tolerance: The differential expression of ZmCASPL genes under various stresses suggests they play roles in stress responses . Recombinant ZmCASPL proteins could be used to identify compounds that enhance their function or stability under stress conditions.

  • Root architecture modification: If ZmCASPL proteins influence root development, as suggested by their expression patterns , manipulation of their expression could potentially modify root architecture for improved drought resistance or nutrient foraging.

  • Biomarkers for stress responses: Recombinant ZmCASPL proteins could be used to develop antibodies or other detection tools for monitoring plant stress responses in the field.

  • Understanding genotype-specific differences: Comparative analysis of ZmCASPL proteins from different maize varieties using resources like the Maize PeptideAtlas could reveal adaptations to specific environmental conditions.

As research progresses, the agricultural applications of ZmCASPL proteins will likely expand, particularly as their roles in stress responses and nutrient uptake become better understood.

How do ZmCASPL proteins compare to their orthologs in Arabidopsis and other plant species?

Comparative analysis of ZmCASPL proteins with their orthologs in other plant species provides valuable evolutionary and functional insights:

  • Structural conservation: The basic protein architecture comprising four transmembrane domains is highly conserved across plant species, suggesting fundamental functional importance .

  • Functional divergence: While Arabidopsis has five CASP members (CASP1-CASP5) that redundantly regulate Casparian strip formation, maize has evolved a much larger family with 47 ZmCASPL members . This expansion suggests potential functional diversification in maize.

  • Phylogenetic relationships: ZmCASPL32 and ZmCASPL42 show close evolutionary relationships with AtCASP1 from Arabidopsis, suggesting they might share functions in Casparian strip development . Other ZmCASPL proteins show varying degrees of similarity to Arabidopsis counterparts.

  • Expression pattern differences: While Arabidopsis CASPs show highly specific expression in the root endodermis, some ZmCASPL genes show broader expression patterns or responses to environmental stresses , indicating potentially expanded functional roles in maize.

  • Domain variations: The presence of MARVEL domains in some ZmCASPL proteins represents an interesting divergence from Arabidopsis CASPs and suggests additional functional capabilities .

When designing experiments with recombinant ZmCASPL3, researchers may benefit from considering functional data from Arabidopsis orthologs as a starting point, while recognizing potential species-specific differences.

What can be learned from studying ZmCASPL proteins across different maize varieties?

Analysis of ZmCASPL proteins across diverse maize germplasm can provide significant insights into their roles in adaptation and agricultural traits:

  • Allelic variations: Different maize varieties may contain allelic variants of ZmCASPL genes that contribute to phenotypic differences in stress tolerance, nutrient use efficiency, or root architecture.

  • Expression differences: Varieties adapted to different environments may show altered expression patterns of ZmCASPL genes. The Maize PeptideAtlas, which includes data from different genetic backgrounds including B73, W22, and various hybrids , can be valuable for such comparisons.

  • Structural polymorphisms: Comparison of ZmCASPL sequences across varieties might reveal selective pressures on different protein domains, indicating functionally important regions.

  • Hybrid effects: Analysis of ZmCASPL expression or function in hybrid varieties compared to their inbred parents could reveal potential heterotic effects relevant to crop improvement.

  • Environmental adaptations: Varieties adapted to specific stresses might show differences in ZmCASPL gene repertoire, regulation, or protein structure that contribute to their resilience.

Resources like the Maize PeptideAtlas, which includes proteomics data from various genetic backgrounds and environmental conditions , provide an excellent foundation for such comparative analyses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.