Recombinant Zea mays CASP-like protein 6

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Zea mays CASP-like protein 6 belongs to the Casparian strip membrane domain protein (CASPL) family, which shares homology with the MARVEL protein superfamily . These proteins are essential for creating plasma membrane subdomains that direct localized lignin polymerization, forming the Casparian strip—a lignin-based barrier in root endodermal cells . While native CASP6 in maize remains functionally uncharacterized, recombinant versions enable biochemical and structural studies to elucidate its role.

3.1. Casparian Strip Formation

CASP-like proteins scaffold lignin-depositing enzymes (e.g., peroxidases, laccases) at the plasma membrane, enabling localized lignin polymerization . In Arabidopsis, CASPs recruit RBOHF and PRX enzymes to modify cell walls . Recombinant CASP6 likely performs a similar role in maize, though experimental validation is pending.

3.2. Nutrient Homeostasis

Disruption of CASP function in mutants leads to ion leakage (e.g., Mg²⁺, K⁺) due to defective Casparian strips . Recombinant CASP6 could restore ion barrier integrity in engineered plant lines, as demonstrated in rice OsCASP1 mutants .

3.3. Stress Adaptation

CASPLs are implicated in drought and salinity tolerance. For example, OsCASP1 in rice regulates suberin deposition under salt stress . Recombinant CASP6 may enhance maize resilience to abiotic stresses, though this requires empirical testing.

4.1. Evolutionary Conservation

CASPLs are phylogenetically related to MARVEL proteins, with conserved transmembrane residues across land plants and green algae . Maize CASP6 clusters within CASPL group 1, which includes functionally validated proteins like AtCASP1 .

4.2. Expression Patterns

Homologous CASPLs in maize (e.g., ZmGLP2-1) show tissue-specific expression in roots and embryos . RNA-seq data suggest ZmCASP-like6 is highly expressed in root endodermal cells, similar to OsCASP1 in rice .

4.3. Interaction Networks

CASP-like proteins interact with:

  • Kinases: RIP1 and RICK homologs (as seen in human CARD6 studies ).

  • Cell wall enzymes: Peroxidases and laccases .

  • Signaling peptides: CIF1/2-SGN3 complexes for strip integrity .

Applications and Future Directions

Recombinant Zea mays CASP-like protein 6 holds potential for:

  • Biotechnological Engineering: Enhancing nutrient-use efficiency in crops via Casparian strip optimization.

  • Stress Tolerance: Modulating suberin and lignin deposition to improve drought/salinity resilience.

  • Basic Research: Resolving structural mechanisms of membrane domain formation using cryo-EM or X-ray crystallography.

Knowledge Gaps

  • Functional Validation: No direct studies on recombinant maize CASP6 exist; inferences rely on homologs .

  • Regulatory Mechanisms: How post-translational modifications (e.g., phosphorylation) affect CASP6 activity remains unknown .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your request as much as possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributors.
Note: All our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CASP-like protein 2A1; ZmCASPL2A1; Salicylic acid-induced protein 1-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-213
Protein Length
full length protein
Species
Zea mays (Maize)
Target Protein Sequence
MSKMAEEKAAAVGGLGGAGAADAAQQQQLAAGEAAAARVRPVETLLRAAPLGLCVAAMTV MLRNQQSNEYGAVAYSDLGGFKYLVYANGLCAAYSLVSAFYTAVPRPATVSRSWLVFLLD QVFTYLILAAGAAAAELLYLAYNGDKEVTWSEACGVFGSFCRQARTSVAITFGTVLCFIL LSLISSYRLFSAYEAPPSSALGSKGVEIAAYPR
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the ZmCASPL gene family and how is it classified?

The ZmCASPL (Zea mays Casparian strip membrane domain proteins like) gene family comprises 47 members identified at the whole-genome level in maize. These members can be systematically classified into six distinct groups based on phylogenetic analysis. Each group contains proteins with similar structures and conserved motifs, suggesting functional similarities within groups. Phylogenetic analysis demonstrates that ZmCASPL proteins and Arabidopsis CASPL proteins (AtCASPL) form six distinct subfamilies: Group I through Group VI, with Group VI being the largest (containing 10 ZmCASPL and 15 AtCASPL proteins) .

What are the structural characteristics of ZmCASPL proteins?

ZmCASPL proteins are characterized by specific structural features that contribute to their function. These proteins typically contain four transmembrane domains with conserved residues located within these regions. Multiple sequence alignment reveals areas of high and low similarity among ZmCASPL family members. Most ZmCASPL genes contain MYB-binding sites (CAACCA) in their promoter regions, which are associated with Casparian strip development. The conserved protein structure suggests evolutionary conservation of function related to membrane domain formation and cell wall modification .

Which ZmCASPL genes show tissue-specific expression in maize?

RNA-seq analysis has revealed that certain ZmCASPL genes demonstrate distinct tissue-specific expression patterns. Most notably, ZmCASPL21 and ZmCASPL47 exhibit high expression specifically in root tissues, suggesting their potential involvement in Casparian strip development in root endodermis. This tissue-specific expression pattern provides important clues about their biological functions. Additionally, ZmCASPL32 and ZmCASPL42 are closely related to AtCASP1 (from Arabidopsis), implying their potential role in endodermal Casparian strip development and selective mineral element absorption in maize .

How do ZmCASPL proteins contribute to plant cellular functions?

ZmCASPL proteins likely function similarly to their characterized homologs in other plant species. They are potentially involved in the formation of specialized membrane domains and directing localized cell wall modifications. In the endodermis, they may contribute to the formation of Casparian strips - crucial diffusion barriers that control selective nutrient uptake. ZmCASPL proteins likely form membrane "fences" or domains that show extremely low turnover once established. Additionally, they may interact with secreted peroxidases to mediate lignin deposition, contributing to cell wall modification at specific sites .

What regulatory elements are found in ZmCASPL gene promoters?

Analysis of the 2kb promoter regions of ZmCASPL genes has identified 26 distinct cis-acting elements, which can be categorized into:

  • Hormone-responsive elements (particularly ABA-responsive elements found in 44 ZmCASPL genes)

  • Growth and development-related elements

  • Biotic and abiotic stress-related elements

  • Site-binding-related elements

  • Light-responsive elements

Notably, specific ZmCASPL genes (ZmCASPL11/17/18/19/20/21/32) possess both ABA-responsive and drought-responsive elements, suggesting roles in drought stress responses via the ABA signaling pathway. Other genes like ZmCASPL11, ZmCASPL24, ZmCASPL38, ZmCASPL43, and ZmCASPL45 contain both jasmonic acid (JA) and salicylic acid (SA) responsive elements, indicating potential functions in disease resistance .

What methodologies are most effective for recombinant expression of ZmCASPL6?

For effective recombinant expression of ZmCASPL6, researchers should consider:

  • Expression system selection: E. coli systems with C-terminal histidine tags have proven effective for similar membrane proteins. For complex post-translational modifications, consider plant-based expression systems.

  • Optimization strategy:

    • Codon optimization for the expression host

    • Use of strong inducible promoters (e.g., T7)

    • Expression at lower temperatures (16-20°C) to enhance proper folding

    • Inclusion of solubility-enhancing fusion partners (MBP, SUMO, etc.)

  • Purification approach:

    • Two-step purification using initial IMAC (immobilized metal affinity chromatography)

    • Secondary purification via size exclusion chromatography

    • Consider detergent screening for membrane protein solubilization

    • Validate protein integrity via Western blotting with anti-His antibodies

  • Activity validation: Employ protein-protein interaction assays to confirm binding with predicted partners such as peroxidases involved in lignin deposition .

How do evolutionary mechanisms contribute to ZmCASPL family diversification?

The ZmCASPL gene family has evolved through multiple duplication events, with two primary mechanisms identified:

  • Whole Genome Duplication (WGD): Analysis indicates WGD has played the predominant role in ZmCASPL gene family expansion. Synteny analysis reveals numerous WGD-derived ZmCASPL gene pairs distributed across the maize genome.

  • Tandem Duplication (TD): Several ZmCASPL genes appear as clusters resulting from tandem duplication events. For example, ZmCASPL18, ZmCASPL19, and ZmCASPL20 form a tandemly duplicated gene set and may function cooperatively.

These duplication events have contributed to functional diversification within the family, allowing specialized functions to develop while maintaining core structural features. The differential retention and subsequent diversification of duplicated genes have been critical in the expansion of the ZmCASPL family, potentially contributing to maize's adaptive capacity across diverse environments .

How do ZmCASPL genes respond to biotic and abiotic stresses?

ZmCASPL genes demonstrate complex and dynamic expression patterns in response to various environmental stresses:

Abiotic stress responses:

  • ZmCASPL5, ZmCASPL13, ZmCASPL25, and ZmCASPL44 show differential expression patterns under PEG (drought simulation) and NaCl (salt stress) treatments

  • Specific ZmCASPL genes respond to heat, cold, and nutrient deficiency (low nitrogen and phosphorus conditions)

Biotic stress responses:

  • Different expression patterns are observed following infection by various pathogens:

    • ZmCASPL11, ZmCASPL14, ZmCASPL27, ZmCASPL3, and ZmCASPL40 are upregulated under Fusarium graminearum infection but downregulated under Rice black-streaked dwarf virus infection

    • ZmCASPL6/7/15/16/18/28/29/36/38/43/45/46 show the opposite pattern

    • ZmCASPL20 demonstrates dramatic upregulation (>13-fold) under Fusarium graminearum infection

Complex response patterns:

  • Some ZmCASPL genes (ZmCASPL10, ZmCASPL11, ZmCASPL35) show oscillating expression patterns (up-down-up) under combined Fusarium and Trichoderma treatments

  • Others (ZmCASPL1, ZmCASPL15, ZmCASPL24, ZmCASPL41) demonstrate the opposite oscillating pattern (down-up-down)

What protein-protein interaction studies should be conducted with recombinant ZmCASPL6?

Based on current knowledge of CASP-like proteins, the following protein-protein interaction studies would be most informative:

  • Interactions with peroxidases: Test interactions with secreted peroxidases that may be involved in lignin deposition at the Casparian strip.

  • Homo-oligomerization analysis: Determine if ZmCASPL6 forms homo-oligomers as part of membrane domain formation using techniques such as:

    • FRET/BRET analysis with fluorescently tagged proteins

    • Co-immunoprecipitation studies

    • Yeast two-hybrid or split-ubiquitin assays optimized for membrane proteins

    • Bimolecular fluorescence complementation (BiFC) in planta

  • Hetero-oligomerization analysis: Test interactions with other ZmCASPL family members, particularly those in the same phylogenetic group.

  • Transmembrane domain interaction analysis: Since conserved residues in CASPL proteins are located in transmembrane domains, conduct targeted mutagenesis of these regions to assess their role in protein-protein interactions and membrane domain formation .

What methodologies can assess ZmCASPL6 role in Casparian strip formation?

To investigate ZmCASPL6's potential role in Casparian strip formation, researchers should consider:

  • Localization studies:

    • Generate fluorescent protein fusions to track ZmCASPL6 subcellular localization

    • Use high-resolution microscopy (STED, SIM) to visualize membrane domain formation

    • Employ time-lapse imaging to monitor protein dynamics during Casparian strip development

  • Loss-of-function analysis:

    • Create CRISPR-Cas9 knockout or RNAi knockdown lines

    • Evaluate endodermal barrier function using apoplastic tracer dyes (e.g., propidium iodide)

    • Assess lignin deposition using histochemical stains (e.g., Basic Fuchsin, Berberine)

  • Gain-of-function studies:

    • Express ZmCASPL6 in heterologous systems to test for membrane domain formation

    • Create ZmCASPL6 overexpression lines and assess impact on Casparian strip development

  • Complementation assays:

    • Express ZmCASPL6 in Arabidopsis casp mutants to test functional conservation

    • Generate chimeric proteins between ZmCASPL6 and AtCASPs to identify functional domains

Experimental ApproachTechniquesExpected OutcomesLimitations
Subcellular localizationConfocal microscopy with ZmCASPL6-FP fusionsMembrane domain formation in endodermisMay alter native protein function
Loss-of-functionCRISPR-Cas9, RNAiDisrupted Casparian strip formation, altered nutrient uptakePotential genetic redundancy
Biochemical interactionCo-IP, Y2H, BiFCIdentification of protein partnersMay not reflect in vivo conditions
Transcriptional regulationChIP-seq, promoter analysisIdentification of upstream regulatorsLimited by antibody availability
Stress responseqRT-PCR under varied conditionsExpression changes during stressMay not reflect protein activity

How can transcriptomic approaches identify ZmCASPL6 regulatory networks?

To uncover the regulatory networks involving ZmCASPL6, researchers should employ:

  • RNA-Seq under varying conditions:

    • Compare transcriptomes across developmental stages to identify co-expressed genes

    • Analyze expression under diverse stresses (drought, salt, pathogen infection)

    • Generate tissue-specific transcriptomes with emphasis on root tissues

  • Network analysis approaches:

    • Construct co-expression networks to identify genes with similar expression patterns

    • Perform weighted gene co-expression network analysis (WGCNA)

    • Identify transcription factor binding motifs in the ZmCASPL6 promoter

  • Integration with other omics data:

    • Combine transcriptomics with proteomics to validate expression patterns

    • Integrate with metabolomics to identify downstream biochemical changes

    • Correlate with phenotypic data from mutant or transgenic lines

  • Comparative transcriptomics:

    • Compare expression patterns with orthologs in other species (e.g., Arabidopsis, rice)

    • Identify conserved and divergent regulatory mechanisms across species

What are the challenges in functional characterization of recombinant ZmCASPL6?

Researchers studying recombinant ZmCASPL6 face several significant challenges:

How do ZmCASPL promoter elements influence stress-responsive expression?

Analysis of ZmCASPL promoters reveals complex regulatory mechanisms:

  • Hormone-responsive elements:

    • 44 ZmCASPL genes contain ABA-responsive elements, suggesting extensive integration with ABA signaling

    • Several ZmCASPL genes contain both JA and SA responsive elements, indicating roles in hormone-mediated defense responses

  • Stress-specific elements:

    • ZmCASPL11/17/18/19/20/21/32 contain both ABA-responsive and drought-responsive elements

    • These genes may represent key stress-responsive ZmCASPLs that integrate drought and ABA signaling

  • MYB binding sites:

    • Most ZmCASPL genes contain MYB-binding sites (CAACCA)

    • These sites are associated with Casparian strip development and may connect ZmCASPL expression to root developmental programs

  • Experimental approaches for promoter analysis:

    • Promoter deletion analysis to identify critical regulatory regions

    • Chromatin immunoprecipitation (ChIP) to identify transcription factors binding to ZmCASPL promoters

    • DNA affinity purification sequencing (DAP-seq) to identify potential regulatory proteins

    • Electrophoretic mobility shift assays (EMSA) to validate specific DNA-protein interactions

What comparative genomic approaches reveal ZmCASPL evolution?

Several comparative genomic approaches can illuminate ZmCASPL evolutionary history:

  • Cross-species comparison:

    • 47 ZmCASPL genes in maize compared to 39 AtCASPL genes in Arabidopsis shows expansion in maize

    • Phylogenetic analysis groups ZmCASPL and AtCASPL proteins into six distinct subfamilies

    • Group VI is the largest subfamily (10 ZmCASPL, 15 AtCASPL), suggesting functional importance

  • Analysis of duplication mechanisms:

    • Whole genome duplication (WGD) appears to have played a more prominent role than tandem duplication

    • Synteny analysis reveals the genomic relationships between duplicated ZmCASPL genes

  • Structure-function relationships:

    • ZmCASPL32 and ZmCASPL42 are closely related to AtCASP1, suggesting potential roles in endodermal Casparian strip development

    • Conserved residues in transmembrane domains point to preserved functional mechanisms across species

  • Taxonomic distribution:

    • CASPL proteins have been identified across the plant kingdom with conservation with the MARVEL protein family

    • The appearance of Casparian strips correlates with the emergence of a CASP-specific signature absent in plants lacking Casparian strips

    • Some plants with modified root structures (e.g., the carnivorous Utricularia gibba) have reduced CASPL gene numbers

How can advanced imaging techniques assess ZmCASPL6 membrane dynamics?

Advanced imaging approaches offer powerful tools for studying ZmCASPL6 membrane dynamics:

  • Super-resolution microscopy:

    • Stimulated emission depletion (STED) microscopy can resolve membrane domains below the diffraction limit

    • Structured illumination microscopy (SIM) can visualize dynamic changes in membrane domain formation

    • Single-molecule localization microscopy (PALM/STORM) can track individual protein movements

  • Live-cell imaging approaches:

    • Fluorescence recovery after photobleaching (FRAP) to measure protein turnover in membrane domains

    • Fluorescence correlation spectroscopy (FCS) to measure diffusion rates within membranes

    • Single-particle tracking to follow individual protein complexes

  • Correlative microscopy:

    • Combine fluorescence imaging with electron microscopy to correlate protein localization with ultrastructural features

    • Integrate with atomic force microscopy to measure mechanical properties of membrane domains

  • Multi-color imaging:

    • Simultaneous visualization of ZmCASPL6 with cell wall components (lignin)

    • Co-visualization with other proteins involved in Casparian strip formation

    • Track relationships between membrane domain formation and cell wall modification

ZmCASPL Family Classification and Characteristics

GroupNumber of ZmCASPL MembersNumber of AtCASPL MembersKey RepresentativesPotential Functions
I41-Unknown
II98-Unknown
III73-Unknown
IV108-Unknown
V74ZmCASPL32, ZmCASPL42Endodermal CS development
VI1015-Unknown

Recommended Protocol for Recombinant ZmCASPL6 Expression

  • Construct Preparation:

    • Optimize codon usage for expression host

    • Include C-terminal 6xHis tag for purification

    • Consider fusion partners (MBP, SUMO) to enhance solubility

    • Include TEV protease cleavage site for tag removal

  • Expression Conditions:

    • Test multiple expression systems (E. coli, yeast, insect cells)

    • For E. coli: Use BL21(DE3) or Rosetta 2 strains

    • Induce at low OD₆₀₀ (0.4-0.6)

    • Express at lower temperature (16-20°C) for 16-20 hours

    • Include membrane protein-specific additives (glycerol, specific detergents)

  • Purification Strategy:

    • Solubilize membrane fraction with appropriate detergents

    • Initial IMAC purification (Ni-NTA)

    • Secondary purification via size exclusion chromatography

    • Verify purity via SDS-PAGE and Western blotting

  • Quality Control:

    • Assess protein folding via circular dichroism

    • Verify oligomeric state via analytical ultracentrifugation

    • Test membrane association using liposome binding assays

ZmCASPL Gene Expression Patterns Under Stress Conditions

Stress TypeUpregulated ZmCASPL GenesDownregulated ZmCASPL GenesNotable Observations
Drought (PEG)ZmCASPL5, ZmCASPL13ZmCASPL25, ZmCASPL44Expression patterns differ based on treatment duration
Salt (NaCl)ZmCASPL25, ZmCASPL44ZmCASPL5, ZmCASPL13Opposite response compared to drought stress
F. graminearumZmCASPL11, ZmCASPL14, ZmCASPL27, ZmCASPL3, ZmCASPL40, ZmCASPL20-ZmCASPL20 shows >13-fold upregulation
Rice black-streaked dwarf virusZmCASPL6, ZmCASPL7, ZmCASPL15, ZmCASPL16, ZmCASPL18, ZmCASPL28ZmCASPL11, ZmCASPL14, ZmCASPL27, ZmCASPL3, ZmCASPL40Opposite patterns compared to F. graminearum
Combined biotic stressesZmCASPL10, ZmCASPL11, ZmCASPL35 (oscillating up-down-up)ZmCASPL1, ZmCASPL15, ZmCASPL24, ZmCASPL41 (oscillating down-up-down)Complex temporal expression patterns

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.