Recombinant Zea mays CASP-like protein 8

Shipped with Ice Packs
In Stock

Description

Production and Purification

This recombinant protein is commercially produced using E. coli expression systems, with protocols optimized for stability and yield:

ParameterSpecification
Storage Temperature-20°C (short-term); -80°C (long-term)
Shelf Life6 months (liquid); 12 months (lyophilized)
Purity>85% (verified via SDS-PAGE)
ReconstitutionDeionized sterile water with 5–50% glycerol
TagN-terminal 10xHis tag

Repeated freeze-thaw cycles are discouraged to maintain protein integrity .

Functional and Evolutionary Context

  • Evolutionary Role: CASPL proteins are evolutionarily related to MARVEL (MAL and related proteins for vesicle trafficking and membrane link) domains, which mediate membrane scaffolding and compartmentalization .

  • Stress Response: While ZmCASPL8 itself has not been directly tested, homologs like ZmCASPL5, ZmCASPL13, and ZmCASPL25 show modulated expression under drought, salt, and pathogen stress .

  • Membrane Localization: CASPL proteins typically form stable membrane domains, as demonstrated in Arabidopsis, where CASPs create diffusion barriers in root endodermal cells .

Research Applications

Recombinant ZmCASPL8 is primarily used in:

  1. Membrane Protein Studies: Investigating CASPL domain formation and interaction with peroxidases or other lignin-related enzymes .

  2. Stress Adaptation Mechanisms: Serving as a candidate gene for abiotic stress tolerance in maize .

  3. Protein-Protein Interaction Assays: Identifying binding partners involved in Casparian strip development or MARVEL-mediated pathways .

Knowledge Gaps and Future Directions

Current limitations include:

  • Unresolved tertiary structure and post-translational modifications.

  • Lack of direct evidence for ZmCASPL8’s role in Casparian strip formation or stress responses.

  • Pathway associations remain theoretical, with no experimentally validated interactors .

Further studies using CRISPR-edited maize lines or heterologous expression in model plants (e.g., Arabidopsis) could clarify its functional niche.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped standard with normal blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
CASP-like protein 2U1; ZmCASPL2U1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Zea mays (Maize)
Target Protein Sequence
MAFTSLLGSDAERKVAVAEVALRAVLCGLGALAAALVATDTQTRTFFSLQKKATYTDMKA MVLLVAAAAAAAGYSLLQAARCCCCVALLRTSIRPRARLLLAWCVFACDQALAYALLAAV VAALQASVVAKQGLPQLQWMAICALYGAFCRQAGAGVACAVAAAVDAALLAFLSAFNLFR LYGAKATTTT
Uniprot No.

Target Background

Database Links

KEGG: zma:100274500

UniGene: Zm.139311

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Zea mays CASP-like protein 8 (ZmCASPL8)?

ZmCASPL8 is a member of the Casparian strip membrane domain protein-like (CASPL) family in maize (Zea mays). It belongs to a group of 47 identified ZmCASPL members in the maize genome that have been systematically classified based on phylogenetic analysis . ZmCASPL8 contains four transmembrane domains, which is a characteristic feature of CASPL proteins. These proteins are ubiquitous in plants and typically feature two intracellular loops, one extracellular loop, and N-terminal and C-terminal residues that exhibit homology with CASP family proteins . Unlike the majority of ZmCASPL proteins that contain CASP domains, ZmCASPL8 specifically contains MARVEL domains, which distinguishes it structurally from some other members of the family .

What are the distinguishing structural features of ZmCASPL8?

ZmCASPL8 is characterized by its MARVEL domains rather than CASP domains, which sets it apart from the majority (72%) of ZmCASPL proteins . The MARVEL domains show high conservation in the transmembrane regions, particularly the first (TM1) and the third (TM3) transmembrane domains . These domains typically feature conserved basic (Arg, His, Lys) and acidic (Asp, Glu) amino acids in TM1 and TM3 respectively, creating a characteristic signature that is shared with the broader MARVEL protein family .

How are CASPL proteins classified in the maize genome?

The CASPL family in maize comprises 47 members (ZmCASPL) that have been systematically classified into six distinct groups based on phylogenetic analysis . This classification reveals evolutionary relationships and potential functional similarities among the proteins:

GroupNumber of ZmCASPL proteinsNotable features
I4Smallest group
II9-
III--
IV10-
V--
VI10Largest group

What is the relationship between CASPs, CASPLs, and the MARVEL protein family?

CASPs (Casparian Strip Membrane Domain Proteins) are specialized four-membrane-span proteins that mediate the deposition of Casparian strips in the endodermis by recruiting the lignin polymerization machinery . CASPLs (CASP-like) represent a larger family of related proteins found throughout the plant kingdom, from green algae to flowering plants .

The relationship extends beyond plants, as homologs of CASPLs outside the plant kingdom were identified as members of the MARVEL protein family . Both CASPLs and MARVELs show high conservation in their transmembrane domains, particularly TM1 and TM3, but less conservation in their extracellular or intracellular regions . This pattern suggests that CASPL and MARVEL domains are likely homologous, with an almost complementary taxonomic distribution between plants and opisthokonts .

Functionally, most CASPLs share with CASPs the ability to form transmembrane scaffolds when expressed in the endodermis, suggesting conservation of this critical function . This functional relationship highlights the evolutionary significance of these membrane-organizing proteins across diverse organisms.

What is the putative function of ZmCASPL8 in maize?

While specific functions of ZmCASPL8 are not directly detailed in the available research, its classification as a CASPL protein suggests potential roles in membrane domain organization and cell wall modification processes . Based on studies of related proteins, ZmCASPL8 likely contributes to:

  • Formation of specialized membrane domains that act as diffusion barriers

  • Organization of plasma membrane components into stable scaffolds

  • Potential involvement in root development processes

  • Response to various abiotic stresses, as observed for other ZmCASPL genes

The protein's MARVEL domains suggest it may have membrane-organizing capabilities similar to other MARVEL-containing proteins . Some ZmCASPL genes show tissue-specific expression patterns, with ZmCASPL21 and ZmCASPL47 being specifically highly expressed only in roots . Determining whether ZmCASPL8 shows similar tissue specificity would provide further insights into its biological role.

How can I design expression vectors for recombinant ZmCASPL8 production?

Designing expression vectors for recombinant ZmCASPL8 production requires careful consideration of several factors to ensure proper protein folding, post-translational modifications, and functional activity:

  • Vector selection and design strategy:

    • For bacterial expression: Consider using pET series vectors with N-terminal tags (His or GST) to facilitate purification

    • For eukaryotic expression: Mammalian (pcDNA), insect (pFastBac), or plant (pCAMBIA) expression systems

    • Include a cleavable tag to remove fusion partners after purification

    • Consider codon optimization for the expression host

  • Construct designs for different applications:

Expression systemVector exampleTag positionPromoterSelection marker
E. colipET28aN-terminal His6T7Kanamycin
Insect cellspFastBac1C-terminal FLAGPolyhedrinGentamicin
Plant cellspCAMBIA1302C-terminal GFPCaMV 35SHygromycin
Mammalian cellspcDNA3.1N-terminal HACMVNeomycin
  • Special considerations for membrane proteins:

    • Include only the soluble domains for bacterial expression if full-length protein expression is challenging

    • For full-length expression, consider specialized vectors with fusion partners that enhance membrane protein solubility (e.g., Mistic, SUMO)

    • In eukaryotic systems, use strong secretory signals to enhance membrane integration

    • Consider the use of nanodiscs or amphipols for membrane protein stabilization after purification

  • Verification and quality control:

    • Include sequencing verification sites flanking the insert

    • Design for integration of epitope tags for antibody detection

    • Consider including TEV or PreScission protease sites for tag removal

This comprehensive approach accounts for the challenges of expressing membrane proteins like ZmCASPL8, which contains four transmembrane domains that may complicate expression and purification .

What methodologies are most effective for analyzing ZmCASPL8 involvement in stress responses?

Analyzing ZmCASPL8's role in stress responses requires a multi-faceted approach combining gene expression analysis, functional studies, and phenotypic characterization:

  • Expression analysis under stress conditions:

    • Apply various abiotic stresses (drought using PEG, salt using NaCl, heat, cold, nutrient deficiency)

    • Collect samples at multiple time points (0h, 6h, 12h, 24h, 48h)

    • Perform RT-qPCR with ZmCASPL8-specific primers and appropriate reference genes

    • Complement with RNA-seq for genome-wide context of expression changes

  • Functional genetic approaches:

    • Generate ZmCASPL8 knockout/knockdown lines via CRISPR-Cas9 or RNAi

    • Create overexpression lines with constitutive or stress-inducible promoters

    • Develop tissue-specific expression systems focused on roots or endodermis

    • Subject transgenic lines to stress conditions and assess phenotypic differences

  • Protein localization under stress:

    • Create ZmCASPL8-fluorescent protein fusions under native promoter

    • Track changes in subcellular localization during stress responses using confocal microscopy

    • Perform co-localization studies with membrane domain markers

  • Physiological and biochemical analyses:

    • Measure root hydraulic conductivity in wild-type vs. transgenic plants under stress

    • Assess ion accumulation (particularly Na+, K+) in shoots of stressed plants

    • Quantify stress hormone levels (ABA, ethylene, jasmonic acid)

    • Measure ROS production and antioxidant enzyme activities

  • Proposed experimental setup for stress response analysis:

Stress typeTreatment conditionsDurationTissue samplingKey measurements
Drought20% PEG-60000-7 daysRoot, leafWater potential, ABA content, hydraulic conductivity
Salt150 mM NaCl0-7 daysRoot, shootNa+/K+ ratio, proline content, membrane integrity
Heat40°C0-24 hoursAll tissuesHSP expression, photosynthetic efficiency, ROS
Cold4°C0-7 daysAll tissuesMembrane fluidity, sugar accumulation, antioxidant activity

Research has shown that various ZmCASPL genes show differential expression under stress conditions, with some members (ZmCASPL5, ZmCASPL13, ZmCASPL25, ZmCASPL44) displaying distinct patterns under PEG and NaCl treatments . This suggests ZmCASPL8 may similarly contribute to stress adaptation mechanisms in maize.

How can the role of ZmCASPL8 in Casparian strip formation be experimentally determined?

Determining ZmCASPL8's role in Casparian strip formation requires specialized approaches focused on this endodermal barrier:

  • Genetic manipulation strategies:

    • Generate ZmCASPL8 knockout lines using CRISPR-Cas9

    • Create endodermis-specific overexpression lines using SCR or CASP1 promoters

    • Develop fluorescent protein fusions to track localization to the Casparian strip domain

    • Engineer chimeric proteins swapping domains with known CASP proteins to identify functional regions

  • Microscopic analysis of Casparian strip integrity:

    • Use propidium iodide staining to assess apoplastic barrier function

    • Apply fluorescent tracer dyes (e.g., fluorescein) to test barrier permeability

    • Perform lignin-specific staining (basic fuchsin or berberine-aniline blue) to visualize Casparian strip structure

    • Employ transmission electron microscopy to examine ultrastructural details

  • Biochemical approaches:

    • Perform co-immunoprecipitation to identify ZmCASPL8 interaction partners

    • Focus on potential interactions with lignin polymerization enzymes (peroxidases)

    • Investigate associations with other components of the Casparian strip machinery:

      • RBOHF (respiratory burst oxidase homolog F)

      • ESB1 (enhanced suberin 1)

      • PER64 (peroxidase 64)

      • UCC1 (uclacyanin 1)

  • Physiological measurements:

    • Assess root hydraulic conductivity in wild-type vs. mutant plants

    • Measure ion uptake rates and nutrient accumulation in shoots

    • Evaluate water movement in roots using pressure probe techniques

  • Cross-species functionality testing:

    • Express ZmCASPL8 in Arabidopsis casp mutants to test for complementation

    • This would reveal functional conservation between species

The key roles of CASP proteins include forming a membrane scaffold at the Casparian strip domain and recruiting lignin polymerization machinery . Interestingly, extracellular loops are dispensable for proper localization, as demonstrated for AtCASP1 , suggesting that the transmembrane domains of ZmCASPL8 would be the focus for functional analysis in Casparian strip formation.

What protein-protein interaction methods are most suitable for identifying ZmCASPL8 binding partners?

Investigating protein-protein interactions involving ZmCASPL8 requires techniques specialized for membrane proteins:

  • Membrane-specific yeast two-hybrid systems:

    • Split-ubiquitin yeast two-hybrid (specifically designed for membrane proteins)

    • Membrane yeast two-hybrid (MbY2H)

    • These systems allow screening of interaction partners while proteins remain membrane-integrated

  • Co-immunoprecipitation approaches:

    • Express epitope-tagged ZmCASPL8 in maize or heterologous systems

    • Use gentle detergents suitable for membrane protein solubilization:

      • n-Dodecyl β-D-maltoside (DDM)

      • Digitonin

      • Styrene maleic acid lipid particles (SMALPs)

    • Perform pull-down with tag-specific antibodies

    • Identify interacting proteins by mass spectrometry

  • Proximity-based labeling techniques:

    • BioID: Fuse ZmCASPL8 to a biotin ligase

    • APEX2: Fuse ZmCASPL8 to an engineered peroxidase

    • These methods label proteins in the vicinity of ZmCASPL8 in living cells

    • Particularly valuable for transient or weak interactions in membrane environments

  • In planta visualization of interactions:

    • Bimolecular Fluorescence Complementation (BiFC)

    • Förster Resonance Energy Transfer (FRET)

    • These techniques allow visualization of interactions in plant cells

    • Can reveal subcellular localization of interaction events

  • Advanced mass spectrometry approaches:

    • Crosslinking mass spectrometry (XL-MS)

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Provide structural information about interaction interfaces

  • Potential interaction partners to investigate:

    • Other ZmCASPL family members (to assess oligomerization)

    • Lignin biosynthesis enzymes (peroxidases, laccases)

    • Cell wall modification enzymes

    • MYB transcription factors (particularly MYB36, which regulates Casparian strip formation)

    • Membrane domain organizational proteins

Based on studies of related proteins, ZmCASPL8 might interact with the lignin polymerization machinery, as observed for CASP proteins . The protein's localization to membrane domains suggests it could form stable protein complexes involved in organizing specialized membrane regions and directing cell wall modifications .

What transgenic approaches can best elucidate ZmCASPL8 function in root development?

Transgenic strategies provide powerful tools for understanding ZmCASPL8's role in root development:

  • Gene knockout/knockdown approaches:

    • CRISPR-Cas9 gene editing for complete knockout

    • RNAi for partial knockdown

    • CRISPR interference (CRISPRi) for conditional repression

    • Analyze resulting phenotypes in:

      • Root architecture (primary root length, lateral root formation)

      • Endodermal differentiation

      • Casparian strip integrity

      • Nutrient uptake efficiency

  • Tissue-specific and inducible expression systems:

Expression systemPromoterApplicationAdvantages
Endodermis-specificZmSCR or ZmCASPTarget expression to Casparian strip-forming tissuePrecise spatial control
InducibleDexamethasone-inducibleTemporal control of expressionAvoid developmental defects
Cell type-specificRoot hair or cortex-specificTest function in different root cell typesTissue-specific phenotypes
Root meristem-specificPLT or WOX5 homologsEarly developmental effectsDevelopmental programming
  • Fluorescent protein fusion constructs:

    • Create N- and C-terminal fusions with fluorescent proteins

    • Express under native promoter to maintain physiological expression patterns

    • Monitor subcellular localization during:

      • Root development

      • Response to environmental stimuli

      • Nutrient availability changes

  • Structure-function analysis:

    • Generate series of deletion/mutation constructs

    • Focus on transmembrane domains, particularly TM1 and TM3 with conserved charged residues

    • Test complementation of knockout phenotypes

    • This approach can identify crucial functional domains

  • Multi-gene approaches:

    • Create double or triple mutants with related ZmCASPL genes

    • This addresses potential functional redundancy

    • Particularly relevant since in Arabidopsis, single casp mutants sometimes show no phenotype while double mutants have defects

These approaches should be complemented with detailed phenotypic analyses, including microscopic examination of root tissue organization, analysis of apoplastic barrier formation, measurement of hydraulic conductivity, and assessment of mineral nutrient translocation to shoots under various environmental conditions.

How do post-translational modifications regulate ZmCASPL8 function?

Understanding post-translational modifications (PTMs) of ZmCASPL8 requires systematic investigation:

  • Predicted PTM sites and their functional implications:

    • Phosphorylation: Likely occurs on cytoplasmic loops and terminal regions

    • Ubiquitination: May regulate protein turnover and membrane trafficking

    • Glycosylation: Potential modification of extracellular loop residues

    • S-acylation: Could anchor protein within membrane microdomains

  • Experimental strategies for PTM identification:

    • Immunoprecipitate ZmCASPL8 from maize tissues

    • Perform high-resolution mass spectrometry analysis

    • Use enrichment strategies for specific PTMs:

      • TiO₂ chromatography for phosphopeptides

      • Lectin affinity for glycopeptides

      • Antibody-based enrichment for ubiquitinated peptides

  • Functional analysis of PTM sites:

    • Create site-directed mutants altering key PTM residues:

      • Phosphomimetic mutations (Ser/Thr to Asp/Glu)

      • Phosphoablative mutations (Ser/Thr to Ala)

      • Lys to Arg mutations to prevent ubiquitination

    • Express in ZmCASPL8 knockout background

    • Assess effects on:

      • Protein localization

      • Protein stability and turnover

      • Casparian strip formation

      • Root development phenotypes

  • PTM dynamics under stress conditions:

    • Compare PTM profiles under normal and stress conditions:

      • Drought stress

      • Salt stress

      • Nutrient limitation

    • This could reveal regulatory mechanisms during stress adaptation

  • Role of PTMs in protein-protein interactions:

    • Investigate whether PTMs create or disrupt binding interfaces

    • Particularly relevant for interactions with cell wall modification machinery

The dynamic localization process observed for CASP proteins—initially targeted to the whole plasma membrane, then removed from lateral membranes to remain exclusively at the Casparian strip membrane domain —suggests active regulatory mechanisms likely involving PTMs. Identifying these modifications would provide crucial insights into how ZmCASPL8 function is regulated during development and stress responses.

What expression pattern does ZmCASPL8 exhibit across different maize tissues and developmental stages?

A comprehensive analysis of ZmCASPL8 expression patterns requires multiple complementary approaches:

  • Tissue-specific expression analysis:

    • Extract RNA from diverse tissues:

      • Primary and lateral roots

      • Root zones (meristematic, elongation, maturation)

      • Shoots and leaves

      • Reproductive tissues (tassels, ears, kernels)

    • Perform RT-qPCR with ZmCASPL8-specific primers

    • Compare with publicly available RNA-seq datasets

    • Create expression heat maps across tissues and developmental stages

  • Cell type-specific expression:

    • Utilize laser capture microdissection to isolate specific cell types:

      • Endodermis

      • Exodermis

      • Pericycle

      • Cortex

    • Perform RNA extraction and qPCR or RNA-seq

    • Alternatively, use single-cell RNA-seq if available

  • Developmental time course:

    • Sample tissues at defined developmental stages:

      • Germination

      • Early seedling development

      • Vegetative growth

      • Reproductive transition

      • Seed development

    • Quantify ZmCASPL8 expression changes

  • Promoter-reporter analysis:

    • Clone the ZmCASPL8 promoter region (~2kb upstream)

    • Create fusion with GUS or fluorescent reporter genes

    • Generate stable transgenic maize plants

    • Visualize reporter expression in different tissues and developmental stages

  • Comparative expression with other ZmCASPL genes:

Tissue typeDevelopmental stageExpression levelComparison to other ZmCASPL genes
Root endodermisEarly development[To be determined]Some ZmCASPLs show endodermis-specific expression
Root steleMaturation zone[To be determined]Compare with ZmCASPL21/47 (root-specific)
Aerial tissuesVarious[To be determined]Expect lower expression if similar to other CASPLs
Stress-exposed tissuesVarious[To be determined]May show upregulation as observed for other CASPLs

Research has shown that some ZmCASPL genes (specifically ZmCASPL21 and ZmCASPL47) are expressed only in roots , suggesting potential tissue specialization within the family. Other ZmCASPL genes show altered expression under various stresses, including drought, salt, heat, cold, nutrient deficiency, and pathogen infection . Understanding whether ZmCASPL8 shares these expression patterns would provide valuable insight into its biological function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.