Recombinant Zea mays Casparian strip membrane protein 1

Shipped with Ice Packs
In Stock

Description

Biological Role of ZmCASP1

Casparian strip membrane domain proteins (CASPs) are transmembrane scaffolding proteins essential for forming lignin-based Casparian strips in plant roots. These strips regulate selective nutrient uptake and stress responses . In maize (Zea mays), CASPL (CASP-like) genes, including potential ZmCASP1 homologs, are critical for root development and stress adaptation .

  • Functional Analogs:

    • In Arabidopsis, CASP1 and CASP3 form a plasma membrane scaffold to localize lignin-polymerizing enzymes (e.g., peroxidases, RBOHF) .

    • ZmESBL, a dirigent protein in maize, interacts with CASP-like machinery to mediate lignin deposition at Casparian strips .

ZmCASPL Gene Family Insights

A genome-wide study identified 47 ZmCASPL genes in maize, with ZmCASPL21 and ZmCASPL47 showing root-specific expression, suggesting roles in Casparian strip development :

GeneExpression PatternStress Responsiveness
ZmCASPL21Root-specificInduced by drought, salt
ZmCASPL47Root-specificLow nitrogen/phosphorus
ZmCASPL5/13Upregulated under NaCl/PEGHeat, cold, pathogen exposure

Hypothetical Production of Recombinant ZmCASP1

While no studies explicitly describe recombinant ZmCASP1, insights from related CASP homologs suggest potential strategies:

  • Expression Systems:

    • E. coli: Commonly used for soluble protein domains.

    • Yeast/Insect Cells: Suitable for full-length transmembrane proteins with post-translational modifications .

  • Functional Validation:

    • Localization assays (e.g., fluorescence tagging) .

    • Interaction studies with lignin-polymerizing enzymes (e.g., peroxidases, ESB1) .

Research Gaps and Future Directions

  • Structural Studies: No CASP structures are available; recombinant ZmCASP1 could enable cryo-EM or X-ray crystallography.

  • Barrier Function Assays: Test recombinant ZmCASP1’s ability to restore Casparian strip integrity in casp mutants .

Key Challenges

  • Membrane Protein Complexity: CASPs are four-transmembrane-domain proteins with low solubility, complicating purification .

  • Functional Redundancy: Maize has 47 CASPL genes, necessitating targeted gene-editing to isolate ZmCASP1-specific roles .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your requirements.
Synonyms
Casparian strip membrane protein 1; ZmCASP1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Zea mays (Maize)
Target Protein Sequence
MKGSSEHGETSKQAPLGSSRGVSKGVSVLDLILRFIAIIGTLASAIAMGTTNETLPFFTQ FIRFKAQYSDLPTLTFFVVANSIVCAYLTLSLPLSIVHIIRSRAKYSRLLLVVLDAAMLA LVTPGASAAAAIVYLAHKGNVRANWLAICQQFDSFCERISGCLIGSFGAMVMLVLLLLLS AIALARR
Uniprot No.

Target Background

Function
This protein regulates membrane-cell wall junctions and localized cell wall deposition. It is essential for establishing the Casparian strip membrane domain (CSD) and subsequent formation of Casparian strips, a cell wall modification of the root endodermis. These strips act as an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm, preventing lateral diffusion.
Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the Casparian strip in maize roots and what roles do ZmCASP proteins play?

    The Casparian strip (CS) serves as a critical diffusion barrier in plant roots, functioning as a "second skin" that provides cellular control for selective entry of water and solutes into the vascular system. This junction is primarily composed of lignin that is polymerized through oxidative coupling of monolignols via NADPH oxidase and peroxidase activity . In maize, Casparian strip membrane domain proteins (CASPs) form a protein scaffold in the plasma membrane where the CS forms, correctly positioning the biosynthetic machinery necessary for CS formation . Recent research has identified 47 ZmCASPL members in the maize genome, classified into six distinct groups, with specific members like ZmCASPL21 and ZmCASPL47 being highly expressed in roots, suggesting their involvement in CS development .

  • How are ZmCASP/ZmCASPL genes structurally organized in the maize genome?

    Genome-wide identification has revealed 47 ZmCASPL members in maize, systematically classified into six distinct groups . Analysis shows that members within the same group of ZmCASPL contain similar gene structures and conserved motifs, suggesting similar functions and regulatory mechanisms . Studies have revealed that most ZmCASPL genes contain MYB-binding sites (CAACCA) associated with Casparian strip development . Evolutionary analysis indicates that whole genome duplication (WGD) played a more prominent role than tandem duplication (TD) in generating the ZmCASPL gene family . This genomic organization provides essential insights for understanding the functional diversification of this gene family in maize.

  • What expression patterns do ZmCASP proteins exhibit in different tissues?

    RNA-seq data analysis has demonstrated that ZmCASPL genes are widely expressed in various maize tissues. Among the 47 ZmCASPL genes, 43 are expressed in roots, with 14 showing high expression in this tissue . Notably, ZmCASPL7/8/18/19/21/24/32/47 are specifically highly expressed in the root, with ZmCASPL21 and ZmCASPL47 exclusively showing high expression in roots . Some ZmCASPL genes exhibit tissue-specific expression patterns - for example, ZmCASPL24, ZmCASPL32, and ZmCASPL47 are highly expressed in anthers, while ZmCASPL2/3/4/15/30/36/47 show high expression in ears . Understanding these tissue-specific expression patterns is crucial for elucidating the diverse functions of different ZmCASPL members.

Advanced Research Questions

  • How can recombinant ZmCASP1 protein be optimally expressed and purified for functional studies?

    For optimal recombinant expression of ZmCASP proteins, researchers should consider:

    • Expression system selection: Bacterial systems (E. coli) are suitable for initial studies, but due to the transmembrane nature of CASPs (containing four transmembrane domains) , eukaryotic expression systems like insect cells or plant-based systems may better maintain native conformation.

    • Construct design: Include appropriate tags (His6 or GST) at the N-terminus rather than C-terminus to minimize interference with protein folding. Consider that the extracellular loops are not essential for membrane scaffold formation as demonstrated in CASP1 studies where deletion of either extracellular loop did not affect localization .

    • Purification strategy: Due to their hydrophobic transmembrane domains, use mild detergents (DDM or LMNG) during extraction. Employ two-step purification combining affinity chromatography and size exclusion chromatography to maintain protein integrity.

    • Functional verification: Assess proper folding through circular dichroism and functionality through in vitro binding assays with known interacting partners like lignin polymerization machinery components.

  • What methodologies are effective for studying ZmCASP protein interactions within the Casparian strip formation machinery?

    Several complementary approaches are recommended:

    • Co-immunoprecipitation (Co-IP): This technique has successfully identified interactions between CASPs and other CS components. For example, studies in Arabidopsis revealed that ESB1 localization to CS requires functional CASPs, as demonstrated by immunogold electron microscopy showing loss of ESB1 localization in casp1-1casp3-1 mutants .

    • Bimolecular fluorescence complementation (BiFC): Split fluorescent proteins fused to potential interaction partners can visualize protein interactions in planta.

    • Fluorescence resonance energy transfer (FRET): FRET with fluorescently-tagged proteins can assess proximity-based interactions in living cells.

    • Yeast two-hybrid screening: Useful for identifying novel interacting partners that may contribute to CS formation.

    • Proximity-dependent biotin identification (BioID): By fusing ZmCASP proteins to a biotin ligase, proteins in close proximity can be biotinylated and subsequently identified by mass spectrometry.

    These approaches should be combined with genetic studies using mutants (such as CRISPR-generated variants) to validate functional significance of detected interactions .

  • How do environmental stresses affect ZmCASP expression and Casparian strip development?

    RNA-seq analyses have revealed that ZmCASPL genes respond dynamically to various environmental stresses:

    • Abiotic stresses: Drought, salt, heat, and cold stresses significantly impact the expression patterns of ZmCASPL genes. RT-qPCR has confirmed that ZmCASPL5/13/25/44 genes show different expression patterns under PEG (simulated drought) and NaCl (salt) treatments .

    • Nutrient stress: Low nitrogen and phosphorus conditions alter ZmCASPL expression, suggesting roles in nutrient-stress adaptation .

    • Biotic stresses: Pathogen infection significantly affects ZmCASPL expression. Some genes exhibit opposite expression trends after different infections; for example, ZmCASPL11, ZmCASPL14, ZmCASPL27, ZmCASPL3, and ZmCASPL40 were upregulated under Fusarium graminearum infection but downregulated under Rice black-streaked dwarf virus infection .

    • Complex stress responses: Some ZmCASPL genes show complex response patterns to combined stresses. For instance, under Fusarium, Trichoderma, and combined Trichoderma and Fusarium stresses, certain genes (ZmCASPL10, ZmCASPL11, ZmCASPL35) first increase, then decrease, and finally increase again in expression .

    These differential responses suggest specialized roles for ZmCASPL members in stress adaptation, which could be exploited for engineering stress-tolerant crops.

  • What are the functional relationships between ZmCASPs and other key proteins in Casparian strip formation?

    ZmCASPs function within a complex protein network for Casparian strip formation:

    • Transcription factor regulation: Most ZmCASPL genes contain MYB-binding sites (CAACCA) that are associated with the Casparian strip . In Arabidopsis, MYB36 directly regulates the expression of main genes involved in CS formation , suggesting similar regulatory mechanisms in maize.

    • Protein scaffolding relationships: CASPs form a protein scaffold that recruits other CS components. For instance, in Arabidopsis, ESB1 (a dirigent-domain containing protein) requires the CASP complex for correct localization to the CS region . The maize homolog ZmESBL (encoded by ZmSTL1) is similarly localized to the CS domain and is essential for lignin deposition .

    • Signaling pathway integration: The CIF1/2-SGN3-SGN1 signaling pathway (peptide-receptor like kinase-coreceptor complex) monitors CS integrity . This pathway likely regulates ZmCASP function and localization in maize.

    • Enzymatic machinery recruitment: CASPs recruit enzymes essential for lignin polymerization, including RBOHF (respiratory burst oxidase homolog F), PER64 (Peroxidase 64), and UCC1 (UCLACYANIN 1) . RBOHF is notably the only transmembrane protein known to accumulate at the CS domain besides CASPs themselves .

    Understanding these protein interactions is crucial for engineering CS properties to enhance plant stress tolerance.

  • How can CRISPR/Cas9 gene editing be applied to study ZmCASP function in maize?

    CRISPR/Cas9 gene editing offers powerful approaches for ZmCASP functional studies:

    • Knockout mutant generation: CRISPR has been successfully used to create frameshift mutations in maize genes. For example, CRISPR-generated mutants of Zm00001d033942 (which encodes a dirigent protein ZmESBL) displayed salt hypersensitivity, demonstrating its role in CS function . Similar approaches can target specific ZmCASP genes to assess their individual and combined contributions to CS formation.

    • Domain modification strategy: Instead of complete gene knockout, targeted modification of specific domains (such as transmembrane regions or extracellular loops) can provide insights into structure-function relationships of ZmCASP proteins. Research in Arabidopsis has shown that extracellular loops are not necessary for CASP1 localization , and similar domain analyses could be performed in maize CASPs.

    • Promoter editing: Modifying MYB-binding sites (CAACCA) in ZmCASP promoters can help elucidate the transcriptional regulation of these genes, particularly for ZmCASPL21 and ZmCASPL47 which are specifically expressed in roots .

    • Reporter gene fusion: CRISPR-mediated knock-in of fluorescent tags can enable in vivo visualization of protein localization and dynamics, similar to studies with ESB1-mCherry in Arabidopsis .

    • Multiplexed editing: Targeting multiple ZmCASP family members simultaneously can overcome functional redundancy issues, as demonstrated in Arabidopsis where single casp mutants showed minimal phenotypes while double mutants exhibited clear CS defects .

  • What roles do ZmCASP proteins play in salt tolerance mechanisms in maize?

    ZmCASP proteins contribute significantly to salt tolerance through several mechanisms:

    • Barrier function regulation: The integrity of the CS barrier, which depends on proper ZmCASP function, is crucial for controlling Na+ transport. Mutants with defective CS barriers (such as those lacking ZmESBL) show increased apoplastic transport of Na+ across the endodermis, leading to increased root-to-shoot Na+ delivery and salt hypersensitivity .

    • Expression adaptations: RNA-seq and RT-qPCR analyses reveal that many ZmCASPL genes show altered expression under salt stress . For example, ZmCASPL5/13/25/44 genes show distinct expression patterns under NaCl treatment , suggesting their involvement in salt stress responses.

    • Salt-specific vs. general stress responses: Some ZmCASPL genes respond differently to salt stress compared to other abiotic stresses, indicating specialized roles in salt tolerance mechanisms .

    • Integration with other barriers: ZmCASP function likely coordinates with suberin deposition pathways, as observed in Arabidopsis where CS defects trigger compensatory suberin deposition . This coordination may provide additional protection against salt stress.

    Understanding these mechanisms could inform genetic engineering strategies to enhance salt tolerance in maize varieties for cultivation in saline soils.

  • How has the ZmCASP gene family evolved compared to other plant species, and what are the functional implications?

    Evolutionary analysis of the ZmCASP gene family reveals:

    • Family expansion patterns: The maize genome contains 47 ZmCASPL members, which is more than the 39 in Arabidopsis but fewer than in cotton species (48 in G. arboreum, 91 in G. barbadense, 94 in G. hirsutum) . This variation correlates with genome complexity, as cotton has a more complex genome than Arabidopsis and maize .

    • Duplication mechanisms: Whole genome duplication (WGD) played a more significant role than tandem duplication (TD) in expanding the ZmCASPL gene family in maize , potentially leading to functional diversification.

    • Conservation across kingdoms: CASPLs are found in all major divisions of land plants and even in green algae. Homologs outside the plant kingdom are identified as members of the MARVEL protein family , suggesting ancient origins and fundamental cellular functions.

    • Structure-function conservation: The propensity to form transmembrane scaffolds appears to be conserved across the CASPL family, as most CASPLs can integrate into the CASP membrane domain when ectopically expressed .

    • Casparian strip-specific signatures: There is a correlation between the presence of a CASP-specific signature (in extracellular loop 1) and the appearance of Casparian strips in plants . This signature is absent in organisms lacking Casparian strips, suggesting its importance for CS formation.

    These evolutionary insights can guide functional predictions and identify promising ZmCASP candidates for crop improvement efforts.

Methodological Research Questions

  • What imaging techniques are most effective for visualizing ZmCASP localization and Casparian strip formation in maize roots?

    Multiple complementary imaging approaches are recommended:

    • Confocal laser scanning microscopy: Essential for visualizing fluorescently tagged ZmCASP proteins. In Arabidopsis, this approach revealed that ESB1-mCherry initially localizes in patches along the equatorial line of endodermal cells before coalescing into a continuous band, similar to CASP1-GFP localization .

    • Immunogold electron microscopy: Provides ultrastructural localization of native ZmCASP proteins. This technique confirmed that ESB1 protein is specifically localized to the Casparian strip in Arabidopsis and showed this localization was lost in esb1-1 mutants .

    • Propidium iodide (PI) staining: A functional assay where this apoplastic tracer's movement into the stele is blocked by intact Casparian strips. This approach revealed delayed barrier development in esb1-1 mutants compared to wild type .

    • Fluorescence recovery after photobleaching (FRAP): Used to analyze protein dynamics and stability in the membrane. CASP proteins show high stability in their membrane domain, presenting hallmarks of a membrane scaffold .

    • Super-resolution microscopy: Techniques like STORM or PALM can provide nanoscale resolution of ZmCASP organization within the CS domain, revealing details of protein scaffolding not visible with conventional microscopy.

    For optimal results, chemical clearing methods should be combined with these imaging techniques to enhance visualization of internal root structures.

  • What transcriptomic approaches best elucidate the regulation of ZmCASP expression under different environmental conditions?

    Several transcriptomic strategies have proven effective:

    • RNA-seq with tissue-specific sampling: Analysis of RNA-seq data from nine different maize organs (root, shoot, leaf base, leaf, leaf tip, ear, anther, endosperm, and embryo) revealed tissue-specific expression patterns of ZmCASPL genes, with 43 of 47 genes expressed in roots and 14 highly expressed in this tissue .

    • Time-course stress response analyses: RNA-seq analyses of maize under various stresses (drought, salt, heat, cold, low nitrogen/phosphorus, and pathogen infection) have revealed dynamic expression changes in ZmCASPL genes . These time-course studies are essential for capturing the temporal dimension of stress responses.

    • RT-qPCR validation: While RNA-seq provides genome-wide views, RT-qPCR offers more precise quantification of expression for specific genes. This technique confirmed that ZmCASPL5/13/25/44 genes show different expression patterns under PEG and NaCl treatments .

    • Single-cell RNA-seq: This emerging technique could provide cell-type specific expression patterns within the root, potentially revealing differences between endodermal cells at different developmental stages.

    • Chromatin immunoprecipitation sequencing (ChIP-seq): This approach can identify transcription factors (particularly MYB family members) that bind to the CAACCA motifs in ZmCASPL promoters, elucidating their transcriptional regulation.

    Integration of these approaches provides comprehensive understanding of ZmCASP expression regulation under diverse environmental conditions.

  • How can functional genomics approaches be applied to study redundancy within the ZmCASP gene family?

    Addressing functional redundancy requires:

    • Systematic mutation analysis: Single and higher-order mutants should be generated and characterized. In Arabidopsis, knockout of atcasp1 or atcasp3 alone did not affect CS formation, while the atcasp1 atcasp3 double mutant showed clear CS defects . Similar approaches in maize would reveal redundancy patterns among ZmCASP members.

    • CRISPR/Cas9 multiplexing: Simultaneous targeting of multiple ZmCASP genes with similar expression patterns or phylogenetic relationships. ZmCASPL21 and ZmCASPL47 are both specifically expressed in roots and contain MYB-binding sites, making them prime candidates for simultaneous targeting .

    • Artificially induced gene silencing: Virus-induced gene silencing (VIGS) or RNAi approaches targeting conserved regions shared among multiple ZmCASP family members can overcome redundancy by silencing multiple genes simultaneously.

    • Dominant negative approaches: Overexpression of modified ZmCASP proteins that can interact with endogenous proteins but disrupt function could overcome redundancy by affecting multiple family members simultaneously.

    • Phylogenetic-guided targeting strategy: Based on phylogenetic analysis, target representative members from each of the six distinct ZmCASPL groups identified in maize , focusing first on groups with root-enriched expression.

    These approaches should be combined with comprehensive phenotyping of root barrier function, mineral nutrient uptake, and stress responses to fully assess the impacts of ZmCASP redundancy.

  • What are the molecular mechanisms by which ZmCASP proteins respond to pathogen infection in maize?

    RNA-seq analyses reveal complex ZmCASP responses to pathogens:

    • Pathogen-specific responses: ZmCASPL genes show differential responses to different pathogens. For example, ZmCASPL11, ZmCASPL14, ZmCASPL27, ZmCASPL3, and ZmCASPL40 are upregulated under Fusarium graminearum infection but downregulated under Rice black-streaked dwarf virus infection .

    • Dynamic expression patterns: Under Fusarium, Trichoderma, and combined Trichoderma and Fusarium stresses, some ZmCASPL genes (e.g., ZmCASPL10, ZmCASPL11, ZmCASPL35) show complex temporal patterns – first upregulated, then decreased, then upregulated again .

    • Potential barrier reinforcement: ZmCASPs likely contribute to pathogen resistance by reinforcing the CS barrier, limiting apoplastic movement of pathogens or their effectors through the endodermis. The expression level of ZmCASPL20 was upregulated more than 13-fold under Fusarium graminearum infection .

    • Cross-talk with other defense pathways: ZmCASP regulation may integrate with broader defense responses, potentially including hormone signaling pathways (salicylic acid, jasmonic acid, ethylene) and PAMP-triggered immunity responses.

    • Cell wall surveillance mechanisms: Studies in Arabidopsis suggest the existence of cell wall surveillance systems that monitor CS integrity and trigger compensatory responses when CS is disrupted . Similar mechanisms likely exist in maize and may be activated during pathogen attack.

    These mechanisms represent potential targets for enhancing broad-spectrum disease resistance in maize.

  • What experimental designs are most appropriate for investigating the role of ZmCASP proteins in nutrient and water transport regulation?

    Comprehensive experimental designs should include:

    • Split-root experimental systems: Growing maize plants with roots divided between different nutrient/stress treatments allows for controlled comparison while maintaining the same shoot environment.

    • Radioactive tracer studies: Using isotope-labeled minerals (45Ca, 32P, etc.) to track nutrient movement from soil to shoot in wild-type versus ZmCASP mutant plants.

    • Hydraulic conductivity measurements: Root hydraulic conductivity (Lpr) measurements under control and stress conditions (NaCl, ABA treatment) can reveal ZmCASP contributions to water transport regulation, as done with CASPL1 studies .

    • Selective barrier function assays: Apoplastic tracers like propidium iodide can assess barrier integrity, as demonstrated in Arabidopsis where esb1-1 mutants showed delayed barrier development .

    • Cell-specific elemental analysis: Techniques like laser ablation ICP-MS can determine elemental composition with cellular resolution, revealing how ZmCASP mutations affect mineral distribution across root tissues.

    • Imaging mass spectrometry: This can visualize the spatial distribution of small molecules and ions in root cross-sections, providing insights into how ZmCASP affects radial transport of various compounds.

    • Microelectrode ion flux measurements: Non-invasive microelectrode techniques can measure real-time ion fluxes across root tissues, helping determine how ZmCASP affects ion movement.

    These experimental approaches should be applied to both ZmCASP mutants and transgenic lines with modified ZmCASP expression to fully understand their roles in nutrient and water transport.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.