Recombinant Zea mays Cell number regulator 10 (CNR10)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance for dry ice shipping; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CNR10; Cell number regulator 10; ZmCNR10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
CNR10
Target Protein Sequence
MYPPKASGDPAAGAAPVTGFPVGGPAASSQWSSGLLDCFDDCGLCCLTCWCPCITFGRVA EIVDRGATSCGTAGALYAVLAYFTGCQWIYSCTYRAKMRAQLGLPETPCCDCLVHFCCEP CALCQQYKELKARGFDPVLGWDRNATMLPPSAQGMGR
Uniprot No.

Target Background

Database Links
Protein Families
Cornifelin family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in roots, leaves, stalks, immature ears and silks.

Q&A

What is the function of Cell Number Regulator 10 in maize?

Cell Number Regulator 10 (CNR10) in maize appears to function as a negative regulator of cell number, similar to other members of the CNR gene family. These genes impact plant and organ size by controlling cell proliferation during development. Evidence suggests that CNR10 is significantly down-regulated in Rice black-streaked dwarf virus (RBSDV)-infected B73 maize plants, indicating its potential role in viral response pathways . The CNR gene family in maize represents members of an ancient eukaryotic family of Cys-rich proteins containing the PLAC8 or DUF614 conserved motif, with demonstrated effects on regulating plant size by controlling cell number .

How does CNR10 relate to other members of the CNR gene family?

CNR10 belongs to the larger Cell Number Regulator gene family in maize, which includes well-characterized members like CNR1 and CNR2. These genes are putative orthologs of the tomato fruit weight gene fw2.2, which accounts for approximately 30% of fruit size variation in tomato . While CNR1 and CNR2 are the closest maize orthologs to the tomato fw2.2 gene, CNR10 represents another member of this gene family with potentially distinct regulatory functions. Research indicates that expression patterns of different CNR genes correlate with tissue growth activity and may contribute to heterosis effects observed in hybrid maize varieties .

What structural features characterize the CNR10 protein?

Like other members of the CNR gene family, CNR10 likely contains the PLAC8 or DUF614 conserved motif, characteristic of this ancient eukaryotic family of Cys-rich proteins . While specific structural information for CNR10 is limited in the available research, comparative analysis with other CNR proteins suggests it would share the core structural elements that define this protein family. The protein structure likely includes domains involved in protein-protein interactions that enable its function in cell cycle regulation.

How does RBSDV infection affect CNR10 expression in different maize genotypes?

RBSDV infection results in significant down-regulation of CNR10 in susceptible maize inbred line B73. This down-regulation appears to be part of a broader response to viral infection, with dramatic changes in differentially expressed proteins (DEPs) enriched in metabolic processes, stress responses, and biosynthetic processes . Comparatively, resistant maize lines like X178 show different viral accumulation patterns, with approximately 10,000 times less viral RNA per 100 ng total RNA at 15 days post-inoculation compared to susceptible B73 lines . This suggests that CNR10 regulation may differ between susceptible and resistant genotypes, potentially contributing to resistance mechanisms.

What molecular mechanisms underlie the regulation of CNR10 during viral infection?

The molecular pathways regulating CNR10 expression during viral infection likely involve complex signaling networks responsive to pathogen detection. Research on RBSDV infection shows that many defense-related genes, including PR1, glutathione-S-transferase, MYB transcription factor family, and WRKY family genes, are dramatically altered during the preliminary stages of infection . CNR10 down-regulation may be connected to these defense response pathways. Additionally, proteomics analyses of RBSDV infection have identified numerous differentially expressed proteins involved in glycolysis, starch metabolism, and plant defense responses, suggesting that CNR10 regulation may be integrated within these broader metabolic and defense networks .

What role might CNR10 play in nitrogen-responsive growth regulation in maize?

While direct evidence linking CNR10 to nitrogen response is not available in the provided research, the role of CNR genes in regulating cell number suggests potential involvement in nitrogen-responsive growth. Maize productivity and nitrogen use efficiency studies have shown that nitrogen application timing and levels significantly affect plant growth parameters, including plant height, number of kernels per cob, and grain yield . The effect of nitrogen on cell proliferation and plant growth could potentially be mediated through regulatory genes like CNR10, particularly if its expression is responsive to nutrient availability signals.

What techniques are most effective for producing recombinant CNR10 protein?

For recombinant expression of CNR10, researchers should consider the following protocol approach:

  • Clone the full-length CNR10 coding sequence from maize cDNA using gene-specific primers designed based on reference sequences.

  • Introduce the amplified CNR10 sequence into an appropriate expression vector (e.g., pET series for bacterial expression or plant-specific vectors for in planta studies).

  • For bacterial expression, transform the construct into an E. coli expression strain (e.g., BL21(DE3)) and induce protein expression with IPTG under optimized conditions.

  • For plant expression systems, consider using Agrobacterium-mediated transformation with vectors containing appropriate plant promoters.

  • Purify the recombinant protein using affinity chromatography (if a tag was incorporated) followed by size-exclusion chromatography to ensure purity.

This approach allows for subsequent functional characterization and structural studies of the recombinant CNR10 protein.

How can RT-qPCR be optimized for accurate quantification of CNR10 expression in RBSDV-infected maize?

For accurate RT-qPCR quantification of CNR10 expression in RBSDV-infected maize, the following methodology is recommended:

  • Harvest tissue samples from maturing zones of the first upper newly developed leaves at 15 days post-inoculation (or at multiple time points for temporal expression analysis) .

  • Extract total RNA using a high-quality RNA isolation reagent (e.g., TRNzol) and treat with RNase-free DNase to eliminate genomic DNA contamination .

  • Synthesize first-strand cDNA using 1 μg total RNA, M-MLV reverse transcriptase, and random hexamer primers .

  • Design CNR10-specific primers with amplicon sizes between 80-150 bp, checking for specificity against the maize genome.

  • Include multiple reference genes (e.g., ZmActin, ZmUbi, ZmGAPDH) for normalization.

  • Always include no-template and no-RT controls in each assay.

  • Use a standard curve method with known quantities of CNR10 plasmid DNA for absolute quantification.

  • Calculate relative expression levels using the 2^(-ΔΔCT) method with appropriate statistical analysis.

This approach ensures reliable quantification of CNR10 expression changes in response to RBSDV infection.

What experimental design is recommended for testing the effects of CNR10 overexpression on maize development?

For testing the effects of CNR10 overexpression on maize development, the following experimental design is recommended:

  • Generate transgenic maize lines overexpressing CNR10 under the control of a constitutive promoter (e.g., ZmUbi) and tissue-specific promoters.

  • Ensure appropriate controls including null segregants and empty vector transformants.

  • Use a randomized complete block design (RCBD) with 3-4 replications to account for environmental variation .

  • Grow plants under controlled conditions with standardized management practices, similar to those described in nitrogen use efficiency studies .

  • Measure multiple developmental parameters at different growth stages, including:

    • Plant height, leaf area, and stem diameter

    • Cell number and size in developing tissues

    • Timing of developmental transitions

    • Reproductive organ development and yield components

  • Conduct detailed phenotypic analyses of cell number and size using microscopy techniques.

  • Compare the results with those obtained from studies of other CNR family members, particularly CNR1, which has been shown to affect plant size as a negative regulator of cell number .

This comprehensive approach will provide robust data on the developmental consequences of CNR10 overexpression.

How should proteomics data be analyzed to understand CNR10's interaction network during viral infection?

To analyze proteomics data for understanding CNR10's interaction network during viral infection:

  • Implement a robust statistical approach for identifying differentially expressed proteins (DEPs) between infected and control samples, using appropriate cutoffs (typically fold change ≥1.5 and p-value <0.05).

  • Conduct subcellular localization analysis of DEPs, as proteomic analyses of RBSDV infection have shown that the majority of DEPs are located in the chloroplast and cytoplasm .

  • Perform functional enrichment analysis using Gene Ontology (GO) terms, focusing on biological processes like metabolic processes, stress responses, and biosynthetic processes that are known to be affected by RBSDV infection .

  • Use protein-protein interaction (PPI) network analysis to identify direct and indirect interactors of CNR10, potentially uncovering functional modules.

  • Apply co-expression analysis to identify genes with similar expression patterns to CNR10 across multiple conditions.

  • Validate key interactions through techniques such as co-immunoprecipitation, yeast two-hybrid assays, or bimolecular fluorescence complementation.

This analytical framework will help elucidate CNR10's position within the cellular response network during viral infection.

What statistical approaches are best suited for analyzing the effect of CNR10 variants on quantitative traits?

When analyzing the effect of CNR10 variants on quantitative traits in maize, researchers should consider the following statistical approaches:

  • For genetic segregation analysis, develop F₂ and BC₁F₂ populations derived from parents with few polymorphisms besides the CNR10 variant of interest, similar to approaches used in fruit weight gene studies .

  • Fix alleles for other known genes affecting the trait of interest, ensuring that only the CNR10 variant is segregating in the population .

  • Grow 10-13 plants per genotype under consistent conditions and measure relevant traits from representative samples (e.g., 20 samples per plant) .

  • Use Student's t-test to determine the significance of trait segregation in each family when comparing homozygous variants .

  • For gene action analysis, evaluate homozygous wild-type, homozygous variant, and heterozygous plants, calculating gene action as D/A, where D = Aa - (AA+aa)/2 and A = (AA-aa)/2 .

  • Conduct experiments across multiple environments to assess genotype-by-environment interactions.

  • For fine mapping approaches, develop molecular markers and screen large populations to identify recombinants in the region containing CNR10 .

These approaches provide rigorous statistical frameworks for establishing genotype-phenotype relationships for CNR10 variants.

How can single-cell genomics data be leveraged to understand cell-type-specific effects of CNR10?

To leverage single-cell genomics for understanding cell-type-specific effects of CNR10:

  • Utilize high-throughput single-cell technologies to analyze >0.7 million nuclei across diverse maize inbreds, following approaches used in recent cell-type-specific cis-regulation studies .

  • Identify cell-type-specific expression patterns of CNR10 across different tissues and developmental stages.

  • Apply population genetics principles to fine-map chromatin accessibility-associated genetic variants that affect CNR10 expression in specific cell types .

  • Analyze the binding sites of transcription factors like TEOSINTE BRANCHED1/CYCLOIDEA/PROLIFERATING CELL FACTOR, which have been identified as prevalent determinants of chromatin accessibility in maize .

  • Integrate chromatin accessibility-associated variants, organismal trait variation, and population differentiation data to understand how CNR10 regulation may have been rewired during maize domestication and adaptation .

  • Compare CNR10 regulatory networks between domesticated maize and its wild progenitor, Z. mays ssp. parviglumis (teosinte), to identify potential selection on cis-regulatory elements during domestication .

This approach will provide unprecedented insight into the cell-specific roles of CNR10 in different genetic backgrounds and developmental contexts.

How does CNR10 function compare between maize and related grass species?

The function of CNR10 likely shows both conservation and divergence across grass species. While specific comparative data for CNR10 is limited, research on the CNR gene family provides insights:

  • The CNR gene family represents an ancient eukaryotic family of Cys-rich proteins containing the PLAC8 or DUF614 conserved motif, suggesting functional conservation across species .

  • In tomato, the related fw2.2 gene functions as a negative regulator of cell number, affecting fruit size, with expression levels correlating inversely with fruit size .

  • In maize, CNR1 has been demonstrated to affect plant size as a negative regulator of cell number, suggesting a conserved role for CNR family members across species .

  • Comparative analysis of CNR genes between domesticated maize and its wild progenitor teosinte may reveal how domestication has shaped the cis-regulatory landscape affecting CNR10 expression .

Understanding the evolutionary conservation and divergence of CNR10 function across grass species provides valuable context for interpreting its role in maize development and stress responses.

What is the relationship between CNR10 and the RBSDV resistance mechanism in maize?

The relationship between CNR10 and RBSDV resistance in maize appears complex:

  • CNR10 is significantly down-regulated in RBSDV-infected susceptible maize inbred line B73, suggesting it is responsive to viral infection .

  • Resistant maize line X178 shows dramatically reduced viral accumulation compared to susceptible B73 (approximately 10,000 times less viral RNA) .

  • Several genetic loci tightly linked to MRDD (Maize Rough Dwarf Disease) resistance have been reported, including two RBSDV resistance quantitative trait loci (QTLs), qMRD8 and qMrdd1, and two simple sequence repeats (SSRs), 6F29R29 and 6F34R34 .

  • Rab GDP dissociation inhibitor alpha (ZmGDIα) has been identified as a quantitative recessive resistance gene to RBSDV .

  • The connection between CNR10 down-regulation and these known resistance mechanisms requires further investigation.

Understanding this relationship could potentially contribute to developing improved resistance strategies against RBSDV infection in maize.

What emerging technologies could advance our understanding of CNR10 function in maize?

Several emerging technologies hold promise for advancing CNR10 functional studies:

  • CRISPR/Cas9 genome editing for creating precise CNR10 knockout and knockin mutations in diverse maize genetic backgrounds.

  • Spatial transcriptomics to map CNR10 expression patterns across tissues with high resolution.

  • Single-cell multi-omics approaches to simultaneously profile gene expression, chromatin accessibility, and protein levels in specific cell types expressing CNR10 .

  • Chromatin interaction analysis (Hi-C, ChIA-PET) to identify long-range interactions between CNR10 regulatory elements and other genomic regions.

  • Advanced phenomics using high-throughput imaging and computational analysis to quantify subtle growth and developmental phenotypes associated with CNR10 variants.

  • Systems biology approaches integrating multi-omics data to position CNR10 within broader gene regulatory and metabolic networks.

These technologies will enable more comprehensive understanding of CNR10's role in maize development and stress responses.

How might recombinant CNR10 be applied in crop improvement strategies?

Potential applications of recombinant CNR10 in crop improvement include:

  • Development of transgenic lines with modulated CNR10 expression to optimize plant architecture and yield components, similar to approaches used with other CNR family members that have shown effects on plant size .

  • Identification and introgression of beneficial CNR10 alleles from diverse germplasm into elite breeding lines through marker-assisted selection.

  • Engineering CNR10 expression to enhance viral resistance, particularly against RBSDV, given its observed down-regulation during viral infection .

  • Optimizing CNR10 expression patterns to improve nitrogen use efficiency in maize, potentially enhancing yield under different nitrogen management regimes .

  • Combining beneficial CNR10 alleles with optimal nitrogen application schedules (e.g., split applications at key developmental stages) to maximize yield while minimizing fertilizer inputs .

These strategies could contribute to developing maize varieties with improved yield stability and resistance to biotic stresses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.