Recombinant Zea mays Cell number regulator 11 (CNR11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
CNR11; Cell number regulator 11; ZmCNR11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
CNR11
Target Protein Sequence
MDIMHGDLRRNGSNQSVPSRHGWIDMEALSPLADQSMPGEWSVGLCDCFGDLHTCCLTLW CPCVTFGRTAEIVDRGSTCCMSGTLYYLLSTIGWQWLYGCAKRSSMRSQYSLRESPCMDC CVHFWCGPCALCQEYTELQKRGFHMAKGISSPPHLPTV
Uniprot No.

Target Background

Database Links

UniGene: Zm.157735

Protein Families
Cornifelin family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does CNR11 relate to other members of the CNR gene family?

CNR11 is one of at least 13 identified CNR family members in maize. The CNR gene family in maize represents putative orthologs of the tomato fw2.2 gene, which is known to regulate fruit size by controlling cell number. While CNR1 has been most extensively studied as a negative regulator of cell number that affects plant size, CNR11 appears to be more distantly related but shares the conserved structural features of the family .

Based on the available research, the CNR gene family can be organized as follows:

CNR MemberTranscript EvidenceFunctionalityPrimary Effect
CNR1YesConfirmed functionalNegative regulator of cell number
CNR2-10YesPresumed functionalVariable, less characterized
CNR11YesPresumed functionalNot fully characterized
CNR12NoLikely nonfunctionalN/A - incomplete gene product
CNR13YesPresumed functionalNot fully characterized

Unlike CNR12, which appears to be nonfunctional and lacks a complete gene product, CNR11 does have transcript evidence suggesting it is expressed in maize tissues .

How do expression patterns of CNR11 compare with other CNR family members during maize development?

Unlike CNR1, which shows differential expression patterns correlated with tissue growth activity and hybrid vigor, specific expression data for CNR11 is more limited in the current research literature. Based on what we know about the CNR gene family more broadly, these genes often show developmentally regulated expression patterns that correlate with periods of active cell division and organ growth .

A comparative analysis of expression patterns might look like:

Developmental StageCNR1 ExpressionCNR11 ExpressionPotential Significance
Early developmentHigh expressionModerate expression*Cell division regulation
Vegetative growthVariable expressionUnknown*Tissue-specific growth regulation
Reproductive developmentDecreased expressionUnknown*May correlate with reduced cell division
Post-pollinationLow expressionUnknown*Stabilization of cell number

*Note: These are inferred patterns based on limited available data about CNR11 specifically. Research gaps exist that would benefit from dedicated expression profiling studies .

What is the evolutionary relationship between CNR11 and cell number regulators in other crop species?

The CNR gene family represents an ancient eukaryotic family of proteins containing the PLAC8 or DUF614 motif. The tomato fw2.2 gene, which accounts for approximately 30% of fruit size variation in tomato, is an ortholog of the maize CNR genes. Analysis of CNR11's evolutionary position within this gene family could provide insights into its potential function .

Evolutionary studies might examine:

  • The degree of conservation between CNR11 and fw2.2 orthologs in other species

  • Selection pressure on CNR11 during maize domestication compared to other CNR genes

  • Potential subfunctionalization events in the evolution of the CNR gene family

Such evolutionary analyses could inform hypotheses about CNR11's specific role in maize development compared to its paralogs and orthologs in other species .

What are the optimal conditions for working with recombinant CNR11 protein in experimental settings?

When working with recombinant Zea mays CNR11 protein:

  • Storage conditions: Store at -20°C for regular use, or at -80°C for extended storage periods. Avoid repeated freeze-thaw cycles by preparing working aliquots that can be stored at 4°C for up to one week .

  • Buffer composition: The protein is typically maintained in a Tris-based buffer with 50% glycerol that has been optimized for protein stability .

  • Experimental considerations:

    • Protein concentration: The standard available quantity is 50 μg, but other quantities may be available for specialized experimental designs

    • When designing binding studies, consider that the tag type on the recombinant protein is determined during the production process and may affect interaction studies

    • For functional assays, the entire protein sequence (158 amino acids) should be considered as the functional unit

What approaches are most effective for studying CNR11 function in planta?

Based on methodologies used for other CNR family members, several approaches could be effective:

  • Transgenic overexpression: Ectopic expression of CNR11 under constitutive promoters could reveal gain-of-function phenotypes, as demonstrated with CNR1 which produced plants with reduced size when overexpressed .

  • CRISPR/Cas9 gene editing: Targeted mutations in CNR11 could reveal loss-of-function phenotypes that might illuminate its role in development.

  • Expression profiling: Characterizing the expression pattern of CNR11 across tissues and developmental stages using qRT-PCR, RNA-seq, or in situ hybridization would provide insights into its potential biological role.

  • Protein interaction studies: Identifying protein partners of CNR11 could reveal the molecular pathways it participates in, particularly if it functions similarly to other CNR proteins in cell cycle regulation.

  • Cell biology approaches: Analyzing cell number, size, and division rates in tissues with altered CNR11 expression could help determine if it functions as a negative regulator of cell number like CNR1 .

How can contradictory phenotypic effects of CNR11 manipulation be reconciled with existing models of cell number regulation?

When analyzing experimental results from CNR11 manipulation studies:

  • Consider dosage effects: The relationship between CNR gene expression and phenotype may not be linear. For example, with fw2.2 in tomato, lower expression correlated with larger fruits and more cells, suggesting a negative regulatory role .

  • Examine tissue specificity: CNR genes may have different effects depending on the tissue context. Effects observed in one organ may not translate to others.

  • Analyze temporal dynamics: The timing of CNR11 expression may be as important as the absolute expression level, as seen with the allelic differences in fw2.2 where expression timing affected fruit size .

  • Evaluate interactions with other CNR genes: Functional redundancy or antagonism between CNR family members could explain unexpected phenotypic outcomes.

To reconcile contradictory data, consider constructing a matrix that accounts for these variables:

ManipulationTissue TypeDevelopmental TimingExpression LevelObserved PhenotypeConsistent with Model?
OverexpressionLeafEarly developmentHigh??
KnockoutLeafEarly developmentNone??
OverexpressionReproductivePost-pollinationHigh??
KnockoutReproductivePost-pollinationNone??

This approach can help identify patterns in seemingly contradictory results .

What statistical approaches are most appropriate for analyzing quantitative phenotypic changes in CNR11 variant lines?

When analyzing phenotypic changes in plants with altered CNR11 expression:

These statistical approaches should be tailored to the specific experimental design and research questions being addressed in CNR11 studies .

How might variation in CNR11 contribute to heterosis effects in maize hybrids?

Heterosis, or hybrid vigor, is particularly pronounced in maize, where F1 hybrid plants show increased height, leaf area, biomass, and ear size, potentially yielding two to three times as much as their inbred parents. CNR genes, as regulators of cell number and organ size, could potentially contribute to these heterotic effects .

For CNR11 specifically, researchers might investigate:

  • Allelic diversity: Characterizing the natural variation in CNR11 sequences and expression patterns among diverse maize inbreds could reveal associations with heterotic groups.

  • Dominance relationships: Determining whether CNR11 alleles exhibit dominant, recessive, or codominant inheritance patterns in hybrids would inform breeding strategies.

  • Epistatic interactions: Examining how CNR11 interacts with other members of the CNR family or other cell cycle regulators could reveal complex genetic networks underlying heterosis.

  • Tissue-specific effects: Analyzing whether CNR11 contributes differently to heterosis in different tissues (leaves, stems, ears) could help target breeding efforts for specific traits .

What experimental designs would best capture the phenotypic effects of CNR11 variants in field trials?

To properly evaluate CNR11 variants in field settings:

  • Randomized complete block design with sufficient replication to account for field heterogeneity

  • Multi-environment trials across different locations and growing seasons to assess genotype × environment interactions

  • Comprehensive phenotyping that includes:

    • Plant architecture measurements (height, leaf size, stem diameter)

    • Cell-level analyses (cell number and size in key tissues)

    • Yield components (ear size, kernel number, kernel weight)

    • Growth rate determinations at different developmental stages

  • Paired isogenic lines differing only in CNR11 alleles to isolate specific effects

  • Inclusion of relevant controls:

    • Wild-type genotypes

    • Known variants of other CNR family members

    • Commercial hybrids as benchmarks

This comprehensive approach would allow researchers to determine whether CNR11 variants contribute meaningfully to desired agronomic traits while accounting for environmental variation and potential pleiotropy .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.