Recombinant Zea mays Cell number regulator 13 (CNR13)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Maize Development

CNR13 regulates plant growth through cell number modulation, not cell size . Key findings include:

  • Mutant Phenotypes: The narrow odd dwarf (nod) mutant (CNR13 loss-of-function) exhibits reduced leaf size, delayed juvenile-to-adult transition, and defective stomata/trichome formation .

  • Overexpression vs. Suppression:

    • CNR1 overexpression reduces plant size, while suppression increases cell number and organ size .

    • CNR13 silencing mimics heterosis-like effects, enhancing vigor and productivity .

Genetic Diversity and Polymorphisms

Nucleotide diversity (π = 0.01719) and linkage disequilibrium (LD) patterns were analyzed across maize populations :

PopulationNucleotide Diversity (π)LD Decay (R² < 0.2)
Inbred Lines0.01312~200 bp
Landraces0.01901~100 bp
Teosintes0.04225<100 bp

Key Polymorphisms:

Variant IDTypeLocationFunctional Impact
SNP2305Non-synonymousExon 2Associated with ear weight (+4.59%), grain weight (+4.61%)
Indel86InsertionIntron 3Higher diversity in intronic regions

SNP2305A (allelic variant) correlates with increased ear-related traits in inbred lines .

Agricultural Applications

CNR13 variants offer potential for maize yield improvement:

  • Ear Traits: SNP2305A enhances ear weight, grain weight, and row number by 4.59–8.42% .

  • Breeding Strategies:

    1. Marker-Assisted Selection: Target CNR13 polymorphisms to improve ear morphology.

    2. Transgenic Approaches: Overexpress/suppress CNR13 to modulate cell number in hybrid crops .

Research Gaps and Future Directions

  • Mechanistic Studies: Elucidate CNR13’s role in gibberellin signaling and pathogen response pathways .

  • Epigenetic Regulation: Explore interactions between CNR13 and lncRNAs in recombination hotspots .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CNR13; Cell number regulator 13; ZmCNR13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-428
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
CNR13
Target Protein Sequence
MASWDNLGELSNIAQLTGLDAVKLISLIVRAASTARLHKRNCRRFAQHLKLIGGLLEQLR VSELRKYPETREPLEQLEDALRRGYLLVNSCQDRSYLYLLAMGWNIVYQFRKAQSEIDNY LRLVPLITLVDNARIRDRLEYIERDQCEYSFDEEDKKVQDALLNPDPCTNPTIVLKKTLS CSYPNLPFNEALRKESEKLQVELQRSQSNMDLGSCEVIQHLLGVTKTVESTIPEKETNVK APEKKGSNYSESKGETAKSFDDDDDYPKKQNGDYPKKQKDTCSTQRCSSQVPYGHDLVSS RGSYSDEWHADLLGCCSKPALCLKTLFFPCGTFSRIASIAKDRPMSSGEACNDIMAYSLI LSCCCYTCCVRRKLRQKLDIAGGCCDDFLSHLLCCCCALVQEWREVEIRGAYSEKTKVTP PACQYMEH
Uniprot No.

Target Background

Gene References Into Functions
  1. Mosaic analysis reveals that mutations in this gene are rescuable by neighboring non-mutant cells. Gene expression profiling comparing wild-type and mutant plants shows upregulation of juvenile-specific and pathogen-defense genes, and downregulation of adult-specific genes. PMID: 28254777
Database Links
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in roots, coleoptiles, leaves, stalks, apical meristems, immature ears, embryos, endosperm, pericarp, silks and tassel spikelets. Not detected in pollen.

Q&A

What is Zea mays CNR13 and what are its key cellular functions?

ZmCNR13 (also known as NOD - NARROW ODD DWARF) is a plant-specific, membrane-localized protein belonging to the PLAC8-containing protein family. It functions as a regulator of cell division, expansion, and differentiation in maize. CNR13/NOD plays a cell-autonomous role in coordinating growth and patterning in response to both developmental and environmental signals .

The protein is enriched in dividing tissues and critically influences the development of specialized cells such as stomata and trichomes. Transcriptomic analysis of nod mutants revealed that CNR13 affects multiple genetic pathways, including leaf patterning factors, gibberellin biosynthesis, and interestingly, pathogen response pathways .

What is the structure and organization of the ZmCNR13 gene and protein?

The ZmCNR13 gene (GRMZM2G027821) produces at least two transcripts: a long (T01) and short (T02) transcript, with T01 being much more abundant . The gene contains multiple exons and introns, with the second exon being a site of critical mutations in nod alleles.

The CNR13 protein maintains key features found in other MCA (MID-COMPLEMENTING ACTIVITY) proteins:

  • Putative transmembrane regions in both N- and C-terminal regions

  • A coil-coiled structural domain

  • An EF-hand-like motif

  • An ARPK region in the N-terminal half

  • A STYcK region

  • A PLAC8 domain (named after human placenta-specific proteins)

CNR13 belongs to subclade 1 of the PLAC8-containing protein family, characterized by the subsequence CLXXXXCPC, whereas many other members contain CCXXXXCPC instead .

How does CNR13 relate to other cell number regulators in plants?

CNR13 is part of the larger CELL NUMBER REGULATOR (CNR) gene family in maize, which includes up to 13 members (CNR1-13) . This family was identified through homology with the tomato fw2.2 gene, a quantitative trait locus that influences fruit size by up to 30% .

In the broader superfamily, CNR1 and FW2.2 proteins (which like CNR13 belong to subclade 1) are known to negatively regulate cell number. The superfamily also includes proteins with other functions, such as those conferring cadmium resistance in plants and proteins involved in calcium influx in plant roots .

What key mutations have been identified in ZmCNR13 and what phenotypes do they produce?

Two primary mutations have been characterized in the CNR13/NOD gene:

  • nod-1: A C to T change in the second exon that converts a glutamine (Q) to a stop codon, resulting in a truncated protein. Both T01 and T02 transcripts are reduced to approximately one-third of wild-type levels in this mutant .

  • nod-2: A missense mutation (C to T) that converts a highly conserved proline (P) to a leucine (L). Transcript levels remain unchanged compared to wild-type .

The nod mutants display pleiotropic phenotypes affecting both vegetative and reproductive development:

Analysis of nod-1 mosaic plants suggests that CNR13/NOD functions cell-autonomously .

What natural variation exists in ZmCNR13 across maize populations and how does it impact phenotypes?

Extensive genetic diversity has been observed in ZmCNR13 across different maize populations. Resequencing of the ZmCNR13 locus in 224 inbred lines, 56 landraces, and 30 teosintes revealed 501 variants (415 SNPs and 86 Indels), with 51 SNPs and 4 Indels located in coding regions .

Nucleotide diversity (θ) decreases from teosintes (θ=42.25) to landraces (θ=19.01) to inbred lines (θ=13.12), indicating reduced genetic diversity during domestication and breeding . Despite this pattern, neutrality tests suggest that ZmCNR13 has escaped from artificial selection during maize domestication .

Association analysis identified significant correlations between ZmCNR13 variants and ear-related traits:

VariantAssociated TraitsPhenotypic Variation Explained
SNP2305 (exon 2)Ear weight (EW)4.59%
SNP2305 (exon 2)Ear grain weight (EGW)4.61%
SNP2305 (exon 2)Ear diameter (ED)4.31%
SNP2305 (exon 2)Ear row number (ERN)8.42%

Lines carrying SNP2305A exhibit higher values for these traits compared to those with SNP2305T .

What approaches are most effective for cloning and expressing recombinant ZmCNR13?

Based on published research, the following methodological pipeline has proven effective for working with ZmCNR13:

DNA Isolation and Amplification:

  • Extract genomic DNA using a modified CTAB method from fresh young leaves at the seedling stage

  • Design primers based on the ZmCNR13 reference sequence (GRMZM2G027821 in B73)

  • Amplify the full coding sequence using high-fidelity PCR

Cloning Strategies:

  • For bacterial expression, consider using the pGEX vector system for GST-tag fusion, which has been successfully used for similar plant proteins

  • Gateway cloning technology offers versatility for transferring the gene between different expression vectors

  • For difficult membrane proteins, ligation-independent cloning (LIC) often provides higher efficiency than traditional restriction enzyme-based methods

Expression Systems:

  • E. coli BL21(DE3) is suitable for initial expression attempts with optimization of induction conditions (temperature, IPTG concentration, induction time)

  • For membrane proteins that aggregate in bacteria, consider eukaryotic expression systems such as yeast (P. pastoris) or insect cells

  • Plant-based expression systems may preserve proper folding and post-translational modifications

Purification Approaches:

  • For GST-tagged proteins, glutathione affinity chromatography can yield approximately 2 mg/L of recombinant protein

  • Thrombin cleavage can effectively remove fusion tags

  • Size exclusion chromatography as a polishing step improves homogeneity

What assays can be used to evaluate recombinant CNR13 function in vitro?

Several functional assays can be employed to assess CNR13 activity:

Protein-Protein Interaction Assays:

  • Pull-down assays using recombinant CNR13 as bait to identify interacting partners

  • Surface plasmon resonance (SPR) to measure binding kinetics with potential partners

  • Yeast two-hybrid screening to identify novel interactions

Cell-Based Assays:

  • Transient expression in plant protoplasts to assess effects on cell division

  • Complementation of nod mutant cells with recombinant protein

  • In vitro cell proliferation assays using plant cell suspensions

Structural Studies:

  • Circular dichroism (CD) spectroscopy to evaluate secondary structure integrity

  • Limited proteolysis to identify stable domains

  • Membrane incorporation assays to assess proper folding and insertion

Given CNR13's role in multiple pathways, investigating its interactions with components of cell division machinery, hormone signaling pathways, and immune response factors would be particularly informative.

How can differential expression analysis help understand CNR13 function across developmental contexts?

Differential expression analysis of CNR13 can provide critical insights into its developmental roles:

Methodology:

  • Collect tissue samples from multiple organs (leaf, stem, root, inflorescence) at defined developmental stages

  • Extract RNA using TRIzol or RNeasy methods optimized for plant tissues

  • Perform RNA-seq or quantitative RT-PCR targeting both T01 and T02 CNR13 transcripts

  • Compare expression patterns between wild-type and nod mutants

  • Correlate expression with cell division rates and developmental transitions

Expected Outcomes:

  • Temporal expression maps revealing when CNR13 is most active

  • Spatial expression patterns identifying tissues with highest CNR13 activity

  • Co-expression networks linking CNR13 to other developmental regulators

  • Identification of environmental conditions that modulate CNR13 expression

This approach has revealed that nod-1 mutants have reduced transcript levels (approximately one-third of wild-type) for both T01 and T02 transcripts, while levels remain unchanged in nod-2 mutants . Further differential expression studies could elucidate how CNR13 interfaces with developmental and environmental response pathways.

What approaches can be used to study the role of CNR13 in cell number regulation and organ development?

Several complementary approaches can illuminate CNR13's role in growth control:

Cellular Imaging and Quantification:

  • Kinematic analysis of cell division rates in developing tissues

  • Confocal microscopy with fluorescent markers for cell proliferation

  • Time-lapse imaging of developing organs in wild-type versus mutant plants

Single-Cell Analysis:

  • Single-cell RNA sequencing of developing tissues to identify cell type-specific functions

  • Cell-specific promoters to drive CNR13 expression in distinct domains

  • Mosaic analysis to study cell-autonomous effects (already shown for nod-1)

Hormone Response Studies:

  • Quantification of hormone levels (particularly gibberellins) in wild-type versus mutant tissues

  • Assess CNR13 expression in response to exogenous hormone application

  • Test genetic interactions between CNR13 and hormone signaling mutants

These approaches would build on existing knowledge that CNR13 functions cell-autonomously to regulate both cell number and cell size, affecting both vegetative and reproductive development .

How does CNR13 interact with the plant immune system?

An intriguing finding is that nod mutants have constitutive upregulation of pathogen response pathways . This connection can be investigated through:

Transcriptomic Approaches:

  • RNA-seq comparison of immune-related gene expression in wild-type versus nod mutants

  • ChIP-seq to identify potential direct regulation of immune genes

  • Time-course analysis of transcriptional responses to pathogen challenge

Pathogen Resistance Assays:

  • Challenge nod mutants with various pathogens to quantify resistance/susceptibility

  • Test if pathogen exposure alters CNR13 expression or localization

  • Evaluate whether CNR13 overexpression affects pathogen resistance

Mechanistic Studies:

  • Co-immunoprecipitation to identify interactions with immune signaling components

  • Protein localization studies during immune responses

  • Metabolomic analysis to identify immune-related compounds affected by CNR13 function

This research direction could reveal novel connections between developmental regulation and immunity, potentially identifying CNR13 as a coordinator of growth-defense tradeoffs.

How can CNR13 variants be utilized for maize improvement strategies?

The natural variation in CNR13 offers several avenues for crop improvement:

Marker-Assisted Selection:

  • Develop molecular markers for favorable alleles like SNP2305A, which is associated with improved ear traits

  • Screen breeding populations for these markers to select superior genotypes

  • Combine favorable CNR13 alleles with other yield-enhancing loci

Allele Mining from Diverse Germplasm:

  • Explore the extensive variation in landraces and teosintes for novel beneficial alleles

  • The 501 identified variants, especially the 51 SNPs in coding regions, provide a rich resource

  • Screen diverse collections for rare variants with enhanced phenotypic effects

Precision Breeding Approaches:

  • CRISPR/Cas9 gene editing to introduce specific beneficial mutations

  • Fine-tuning of CNR13 expression levels to optimize cell number and size

  • Targeted modification of protein interacting domains to alter specific functions

These strategies leverage the finding that CNR13 variants explain 4.31-8.42% of variation in key ear traits like ear weight, grain weight, diameter, and row number .

What pleiotropic effects should be considered when manipulating CNR13 in breeding programs?

When utilizing CNR13 in breeding programs, researchers should monitor several potential pleiotropic effects:

Growth-Defense Tradeoffs:

  • nod mutants show constitutive upregulation of pathogen response pathways

  • Favorable growth alleles may compromise disease resistance

  • Field testing under disease pressure is essential for CNR13-focused breeding

Developmental Timing Effects:

  • CNR13 affects juvenile-to-adult transition

  • Modified alleles might alter flowering time or developmental phase transitions

  • Phenological changes could affect adaptation to specific growing seasons

Cell Type-Specific Impacts:

  • CNR13 influences specialized cell differentiation (stomata, trichomes)

  • Changes could affect transpiration efficiency or pest resistance

  • Microscopic evaluation of cellular phenotypes should accompany yield trials

Environmental Sensitivity:

  • CNR13 coordinates responses to environmental cues

  • Superior alleles in one environment may underperform in others

  • Multi-location testing is critical for CNR13-based breeding

A comprehensive breeding strategy should balance these considerations while selecting for improved yield components.

What novel approaches could advance our understanding of CNR13 structure-function relationships?

Several cutting-edge approaches could significantly advance CNR13 research:

Structural Biology:

  • Cryo-electron microscopy to determine the membrane-embedded structure

  • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

  • In silico molecular dynamics simulations to predict conformational changes

  • AlphaFold2 or similar AI-based structure prediction followed by experimental validation

Protein Engineering:

  • Domain swapping between CNR family members to identify functional regions

  • Site-directed mutagenesis of key residues (e.g., the CLXXXXCPC motif)

  • Creation of chimeric proteins with fluorescent tags for live imaging

  • Development of optogenetic or chemically-inducible CNR13 variants

Interactome Mapping:

  • Proximity labeling approaches (BioID, TurboID) to identify neighboring proteins

  • Affinity purification-mass spectrometry under various developmental conditions

  • Protein complementation assays to validate interactions in planta

  • Yeast three-hybrid screens to identify complexes rather than binary interactions

These approaches would help determine how CNR13's structure relates to its diverse functions in controlling cell division, expansion, and differentiation.

How might single-cell technologies reveal new insights about CNR13 function?

Single-cell approaches offer unprecedented resolution for understanding CNR13's role:

Single-Cell RNA Sequencing:

  • Profiling transcriptomes of individual cells in developing organs with or without functional CNR13

  • Identifying cell type-specific responses to CNR13 perturbation

  • Constructing developmental trajectories to pinpoint when and where CNR13 exerts its effects

  • Integration with spatial transcriptomics to maintain tissue context information

Single-Cell Proteomics:

  • Quantifying protein abundance and post-translational modifications at single-cell resolution

  • Detecting cell type-specific CNR13 interacting partners

  • Measuring signaling pathway activation states in response to CNR13 activity

Live Cell Imaging:

  • Real-time visualization of CNR13 dynamics during cell division and differentiation

  • Correlation of CNR13 localization with cellular behaviors

  • Measurement of protein turnover rates in different cell types

Recent advances in single-cell RNA sequencing of plant tissues, as demonstrated for maize shoot apical meristem research , provide a powerful framework for applying these technologies to CNR13 studies.

How conserved is CNR13 function across plant species and what can we learn from comparative studies?

CNR13 belongs to an evolutionarily conserved family with members across plant species:

Conservation Patterns:

  • CNR13 is the maize homolog of MCA (MID-COMPLEMENTING ACTIVITY) proteins

  • Related to tomato FW2.2, which regulates fruit size

  • Family members are found in Arabidopsis thaliana and rice

  • Key domains (PLAC8, transmembrane regions) are widely conserved

Functional Conservation and Divergence:

  • Cell number regulation appears to be a conserved function across species

  • CNR13 has broader developmental roles compared to some family members

  • Species-specific adaptations likely reflect diverse growth strategies

Comparative Study Approaches:

  • Phylogenetic analysis of CNR family across plant clades

  • Cross-species complementation experiments

  • Domain conservation analysis among orthologs

  • Expression pattern comparison in equivalent developmental contexts

Insights from such comparative approaches could reveal fundamental principles of plant growth regulation and highlight specialized adaptations in maize.

What evolutionary forces have shaped CNR13 diversity in maize and its wild relatives?

The evolutionary history of CNR13 reveals interesting patterns:

Diversity Gradient:

  • Highest nucleotide diversity in teosintes (θ=42.25)

  • Intermediate in landraces (θ=19.01)

  • Lowest in inbred lines (θ=13.12)

Selection Patterns:

  • Neutrality tests suggest CNR13 has escaped direct artificial selection during domestication

  • Lower nucleotide polymorphism in exons (1 SNP per 25.71 bp) compared to introns (1 SNP per 11.28 bp) indicates purifying selection on coding regions

  • Positive Tajima's D in inbred lines suggests a lack of rare alleles in this population

Population Structure Effects:

These patterns suggest that while CNR13 wasn't a primary target during domestication, its sequence has been influenced by indirect selection and population bottlenecks. The retention of functional significance despite this history highlights CNR13's fundamental importance in plant development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.