Recombinant Zea mays Cell number regulator 1 (CNR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
CNR1; Cell number regulator 1; ZmCNR01
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
Target Protein Sequence
MYPSAPPDAYNKFSAGAPPTAPPPPAAYHQQQQQHGANMDTSRPGGGLRKWSTGLFHCMD DPGNCLITCLCPCVTFGQVADIVDKGTCPCIASGLVYGLICASTGMGCLYSCLYRSKLRA EYDLDEGECPDILVHCCCEHLALCQEYRELKNRGFDLGIGWEANMDRQRRGVAGGGAVMG APPAIPLGMIR
Uniprot No.

Target Background

Function
Acts as a negative regulator of cell number.
Gene References Into Functions
  1. CNR2 expression negatively correlates with tissue growth activity and hybrid seedling vigor. Cosuppression of endogenous CNR1 enhances plant growth. Overexpression of CNR1 reduced plant and organ size. [CNR1] PMID: 20400678
Database Links
Protein Families
Cornifelin family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in roots, coleoptiles, stalks and silks. Detected in leaves, apical meristems, immature ears and pericarps. Highest expression in coleoptiles and silks.

Q&A

What is Zea mays CNR1 and how was it discovered?

CNR1 (Cell Number Regulator 1) is a key gene in maize (Zea mays) that functions as a negative regulator of cell number, directly influencing plant and organ size. It was identified as part of a larger effort to find maize orthologs of the tomato fw2.2 fruit weight gene. Researchers isolated the maize CNR gene family through comparative genomic approaches, with CNR1 showing the closest relationship to the tomato fw2.2 gene .

The CNR family represents an ancient eukaryotic family of cysteine-rich proteins containing the PLAC8 or DUF614 conserved motif. Phylogenetic analysis places CNR1 in subclade 1 of this larger superfamily, which contains the sequence motif CLXXXXCPC that distinguishes it from other family members (which typically contain CCXXXXCPC) .

How does CNR1 affect plant development and morphology?

CNR1 functions primarily by regulating cell proliferation rather than cell expansion. Experimental studies have demonstrated that:

This regulatory mechanism has significant implications for understanding plant growth control systems. Leaf epidermal cell counts in transgenic lines confirmed that increased or decreased plant and organ size resulted directly from changes in cell number .

What is the relationship between CNR1 and plant heterosis?

The effects of CNR1 on plant size and cell number show intriguing parallels with heterosis (hybrid vigor), where F1 hybrid plants exhibit increased height, greater leaf area, increased biomass, and larger ear size compared to their inbred parents. In maize specifically, heterosis can result in yield increases of two to three times that of inbred parents .

The similarity in phenotypic outcomes suggests a potential relationship between CNR1 function and heterosis mechanisms, as both primarily operate through changes in cell number rather than cell size. This connection offers an important avenue for investigating the molecular basis of heterosis, which remains incompletely understood despite its agricultural importance .

How does CNR1 fit within broader evolutionary and functional protein groups?

CNR1 belongs to a superfamily that contains proteins with at least two partially characterized functions:

  • Proteins conferring cadmium resistance in plants (also functional when transformed into fungi)

  • Proteins involved in calcium influx in plant roots (also functional in fungi)

Protein SubfamilyKey Sequence MotifKnown FunctionsExamples
CNR1/FW2.2-like (Subclade 1)CLXXXXCPCCell number regulationMaize CNR1, Tomato FW2.2
Cadmium resistance proteinsCCXXXXCPCCadmium toleranceVarious plant Cd-resistance proteins
Calcium influx regulatorsVariableCalcium signalingRoot calcium influx proteins

This placement within a wider functional context suggests potential additional roles for CNR1 beyond cell number regulation, possibly including metal ion responses or calcium signaling pathways .

What methodologies are recommended for studying CNR1 function in transgenic systems?

Researchers studying CNR1 function should consider multiple complementary approaches:

Expression Manipulation:

  • Ectopic overexpression using strong constitutive promoters (e.g., 35S)

  • RNA interference or CRISPR-Cas9 systems for gene silencing

  • Tissue-specific expression systems to target effects to particular organs

Functional Analysis:

  • Quantitative cell counting in target tissues (e.g., leaf epidermis)

  • Plant and organ size measurements across developmental stages

  • Transcriptome analysis to identify downstream regulated genes

  • Protein interaction studies to elucidate molecular mechanisms

When designing experiments, researchers should be attentive to potential phenotypes in multiple tissues and at various developmental stages, as CNR1 effects may manifest differently depending on context .

How can recombinant CNR1 protein be produced for biochemical studies?

While the search results don't provide specific methods for recombinant CNR1 production, the following protocol can be derived from standard approaches for plant protein expression:

  • Clone the full-length CNR1 coding sequence from maize cDNA using high-fidelity polymerase

  • Insert into an appropriate expression vector with affinity tags (His6, GST, or MBP) to facilitate purification

  • Express in a heterologous system:

    • E. coli systems for basic protein studies

    • Insect cell systems for potential post-translational modifications

    • Plant-based expression systems for authentic modifications

  • Optimize expression conditions (temperature, induction timing, media composition)

  • Purify using affinity chromatography followed by size exclusion chromatography

  • Validate protein activity through functional assays

When working with recombinant CNR1, researchers should consider the potential importance of post-translational modifications and protein-protein interactions that may be important for authentic function.

What are effective approaches for analyzing CNR1 expression patterns in plant tissues?

Researchers studying CNR1 expression should employ multiple complementary techniques:

Transcriptional Analysis:

  • Quantitative RT-PCR for tissue-specific expression levels

  • RNA-Seq for genome-wide expression patterns

  • In situ hybridization to visualize spatial expression patterns

Translational/Protein Analysis:

  • CNR1-specific antibodies for Western blot and immunolocalization

  • Reporter gene fusions (GUS, GFP) to visualize expression patterns

  • Chromatin immunoprecipitation (ChIP) to identify regulatory elements

The search results indicate that CNR1 expression is regulated in connection with tissue growth activity, suggesting that temporal sampling across developmental stages is critical .

How should researchers design experiments to investigate CNR1's role in heterosis?

Given CNR1's potential connection to heterosis, researchers might design experiments that:

  • Compare CNR1 expression levels between inbred lines and their hybrid progeny

  • Evaluate allele-specific expression in hybrids to detect potential regulatory differences

  • Create transgenic plants with modified CNR1 levels in both inbred and hybrid backgrounds

  • Perform detailed phenotypic analyses, focusing on:

    • Cell number counts in multiple tissues

    • Growth parameters correlated with heterotic effects

    • Yield components under field conditions

  • Investigate protein-protein interactions that might differ between inbred and hybrid plants

These approaches could help determine whether CNR1 is a contributor to heterosis or merely mimics heterotic effects through similar cellular mechanisms .

How can researchers differentiate between direct and indirect effects of CNR1 manipulation?

Distinguishing direct from indirect CNR1 effects requires systematic approaches:

  • Temporal analysis - Monitor gene expression changes across a time course following CNR1 induction/repression to identify primary vs. secondary responses

  • Cell-type specific analysis - Use cell sorting or single-cell transcriptomics to isolate effects in specific cell populations

  • Integration with chromatin studies - Combine expression data with chromatin accessibility and modification data to identify direct regulatory relationships

  • Protein-DNA interaction studies - Use ChIP-seq or similar approaches if CNR1 has DNA-binding potential

  • Network analysis - Apply computational approaches to place CNR1 within regulatory networks

These approaches can help establish causal relationships rather than mere correlations in CNR1 function.

What statistical considerations are important when analyzing phenotypic data from CNR1 studies?

When analyzing phenotypic data from CNR1 manipulation experiments, researchers should:

  • Employ appropriate experimental designs with sufficient biological replicates (minimum n=10 for plant phenotypes)

  • Account for environmental variation using randomized complete block designs or similar approaches

  • Use mixed-effect models that can accommodate random environmental effects and fixed genotype effects

  • Consider non-normal distributions of cell count data, which may require transformation before parametric analysis

  • Implement multiple comparison corrections when analyzing multiple traits or time points

  • Quantify effect sizes rather than relying solely on p-values to determine biological significance

These statistical approaches will improve the robustness and reproducibility of CNR1 functional studies.

What potential applications exist for CNR1 in crop improvement?

The fundamental role of CNR1 in regulating plant and organ size through cell number control suggests several potential applications in crop improvement:

  • Modulated expression to optimize plant architecture - Tissue-specific silencing could increase leaf area, stem thickness, or reproductive organ size

  • Fine-tuning of source-sink relationships - Differential expression in photosynthetic vs. storage tissues

  • Enhancement of stress tolerance - Potential connections to stress response pathways through the related cadmium resistance proteins

  • Heterosis manipulation - If CNR1 contributes to heterosis, its manipulation could potentially capture heterotic effects in non-hybrid contexts

The search results specifically note that genes like CNR1 "may aid generation of more vigorous and productive crop plants" and suggest "potential for application to crop improvement" .

What are the most significant knowledge gaps in our understanding of CNR1 function?

Despite the insights gained into CNR1 function, several important questions remain:

  • Molecular mechanism - How does CNR1 regulate cell division at the molecular level? Does it interact with cell cycle machinery directly?

  • Upstream regulation - What environmental and developmental signals control CNR1 expression?

  • Evolutionary conservation - How conserved is CNR1 function across diverse plant species?

  • Protein interactions - What proteins interact with CNR1 to mediate its effects?

  • Subcellular localization - Where within the cell does CNR1 protein function?

  • Relationship to other CNR family members - How do the functions of different CNR proteins overlap or differ?

Addressing these questions will require integrated approaches combining molecular genetics, biochemistry, cell biology, and systems biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.