Recombinant Zea mays Cell number regulator 2 (CNR2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CNR2; Cell number regulator 2; ZmCNR02
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
Target Protein Sequence
MYPKAADEGAQPLATGIPFSGGGGYYQAGGAMAAAFAVQAQAPVAAWSTGLCNCFDDCHN CCVTCVCPCITFGQTAEIIDRGSTSCGTSGALYALVMLLTGCQCVYSCFYRAKMRAQYGL QVSPCSDCCVHCCCQCCALCQEYRELKKRGFDMSIGWHANMERQGRAAAAVPPHMHPGMT R
Uniprot No.

Target Background

Function
May act as a negative regulator of cell number.
Gene References Into Functions
  1. CNR2 expression negatively correlates with tissue growth activity and hybrid seedling vigor. Cosuppression of endogenous CNR1 enhances plant growth. Overexpression of CNR1 reduced plant and organ size. [CNR2] PMID: 20400678
Database Links
Protein Families
Cornifelin family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in leaves, stalks and tassel spikelets. Detected in roots, apical meristems and immature ears, but not in pollen. In leaves, not detected in the cell division zone, expressed at low levels in the cell expansion and transition zones and at high l

Q&A

Basic Research Questions

  • What is the relationship between cell number regulation and genetic recombination in maize?

    Cell number regulation genes interact with meiotic recombination pathways that establish chromosomal crossovers. In maize, nearly 500 DNA double-strand breaks (DSBs) lead to the formation of approximately 20 crossovers during meiosis . This regulation is critical as crossover formation influences genetic diversity and potentially impacts cellular development patterns. Methodologically, researchers can investigate this relationship by analyzing recombination nodules through electron microscopy or immunolocalization of key proteins like MLH1 that mark crossover sites.

  • How does variation in DSB numbers affect cell regulation pathways in different maize inbreds?

    Different maize inbreds exhibit significant variation in DSB numbers, with some showing greater cell-to-cell variability than others. Notably, inbreds with fewer DSBs display proportionally larger cell-to-cell variability (coefficient of variation = 18% in Mo18w and 28% in CML228) compared to inbreds with more DSBs (coefficient of variation <10%) . This variation suggests that DSB number regulation, rather than regulation of the entire recombination pathway, differs between inbreds with high and low DSB numbers. This has implications for understanding how cellular processes are regulated across genetically diverse maize lines.

  • What methods are most effective for studying cell-type specific gene expression in maize?

    Single-cell genomics approaches have revolutionized the study of cell-type specific gene expression in maize. Recent research has utilized single-nuclei chromatin accessibility profiling across diverse maize inbreds, analyzing approximately 1.37 million seedling nuclei across 172 distinct lines . This methodology allows researchers to identify cell state-specific chromatin accessibility quantitative trait loci (caQTL) that would be missed in bulk tissue analysis. For effective implementation, researchers should isolate intact nuclei under conditions that preserve chromatin structure, followed by library preparation protocols optimized for single-cell resolution.

Advanced Research Questions

  • How do gene structure differences impact expression patterns of regulatory genes across species?

    Gene structure differences significantly impact expression patterns of regulatory genes across species. Comparative genomic studies reveal that homologous genes can exhibit distinct isoform expression patterns due to divergence in gene structures. For instance, in cannabinoid receptor genes, human, rat, and mouse genomes show deviations in gene structures and isoform expression patterns . While this example is from mammalian systems, similar principles apply to plant regulatory genes. In maize, multiple promoters and alternative splicing can generate tissue-specific isoforms with distinct expression profiles, allowing for specialized regulatory functions in different cellular contexts.

  • What are the mechanisms of crossover homeostasis in maize compared to other model organisms?

    Crossover homeostasis differs significantly between maize and other model organisms. While budding yeast, C. elegans, and mouse exhibit strong crossover homeostasis (maintaining stable crossover numbers despite variations in DSB numbers), maize shows weaker homeostatic control . The table below compares key aspects of crossover homeostasis across species:

    SpeciesRelationship between DSB and CO numbersHomeostasis strengthReference
    MaizeCO numbers change with DSB numbersWeaker
    YeastCO numbers stable despite DSB variationStronger
    MouseProgressive homeostatic controlStronger
    C. elegansCO numbers stable despite DSB variationStronger

    Methodologically, homeostasis can be studied by quantifying recombination intermediates at different stages using immunofluorescence microscopy to track proteins like RAD51 (early) and MLH1 (late).

  • How does transposon activity shape the cis-regulatory landscape in domesticated maize?

    Transposon activity has been a significant driver in shaping the cis-regulatory landscape of domesticated maize. Single-cell genomic studies have revealed that historical transposon activity created transposon-derived cis-regulatory elements unique to domesticated maize . These elements contribute to accessible chromatin regions (ACRs) that regulate gene expression in specific cellular contexts. Methodologically, researchers can identify transposon-derived regulatory elements by combining single-nuclei ATAC-seq with comparative genomics between maize and its wild relatives, followed by motif enrichment analysis to determine which transcription factor binding sites are embedded within these transposon-derived sequences.

  • What role do transcription factor binding sites play in determining chromatin accessibility variation in maize?

    Transcription factor binding sites (TFBSs) are critical determinants of chromatin accessibility in maize. Research has identified that variants in TEOSINTE BRANCHED1/CYCLOIDEA/PROLIFERATING CELL FACTOR (TCP) binding sites are the most prevalent determinants of chromatin accessibility . Fine-mapping of chromatin accessibility quantitative trait loci (caQTL) has revealed approximately 22,053 putatively causal variants that affect chromatin accessibility at cell-type resolution . These variants often perturb TFBSs, leading to differential transcription factor occupancy between alleles. To study this phenomenon, researchers should employ differential TF footprinting analysis between contrasting haplotypes, revealing approximately 25,000 allele-specific TF footprints per cell state .

  • How can researchers integrate chromatin accessibility data with population genetics to understand adaptation in maize?

    Integration of chromatin accessibility data with population genetics provides powerful insights into maize adaptation. Researchers should:

    1. First identify cell state-resolved caQTL-ACRs (accessible chromatin regions with quantitative trait loci)

    2. Cross-reference these with GWAS hits for agronomic traits

    3. Calculate population differentiation statistics to identify selective sweeps

    4. Analyze transcription factor binding site disruptions within these regions

    This approach has successfully identified mesophyll-specific caQTL-ACRs associated with plant height that were embedded within selective sweeps in temperate non-stiff stalk germplasm . These integrative analyses reveal how local adaptation has rewired regulatory networks in unique cellular contexts to alter maize flowering and adaptation to temperate climates.

  • What methodological approaches can resolve contradictions in gene expression data across different maize tissues?

    Resolving contradictions in gene expression data across maize tissues requires multi-faceted methodological approaches:

    1. Single-cell resolution analyses: Employ single-cell RNA-seq and ATAC-seq to identify cell-type specific expression patterns that might be masked in bulk tissue analyses

    2. Isoform-specific quantification: Design TaqMan probes targeting specific isoforms from alternative promoters, similar to approaches used for cannabinoid receptor gene variants

    3. In situ verification: Validate expression patterns through RNA in situ hybridization to precisely localize expression in tissue contexts

    4. Genetic perturbation: Perform CRISPR-based disruption of regulatory elements to verify their contribution to expression patterns

    5. Allele-specific expression analysis: Sequence F1 hybrids to quantify allele-specific expression patterns that might reveal cis-regulatory differences

    Contradictions often arise when tissue heterogeneity confounds bulk analyses or when technical factors introduce bias. Employing multiple orthogonal techniques enables researchers to triangulate the true biological signal.

  • How does genetic mapping of chromatin accessibility differ between maize and other model plant systems?

    Genetic mapping of chromatin accessibility in maize offers unique advantages compared to other model plant systems. Maize exhibits substantially lower linkage disequilibrium (LD) (r²=0.2 at ~1.4-kb) compared to humans (r²=0.2 at 50-kb) and mice (r²=0.2 at 200-kb) , providing much higher mapping resolution. This genetic property allows researchers to more precisely identify causal variants associated with chromatin accessibility.

    Methodologically, researchers should:

    1. Utilize diverse panels like the Goodman-Buckler diversity panel with 172+ inbred lines

    2. Perform single-nuclei ATAC-seq across this population

    3. Employ mixed linear models that account for population structure

    4. Apply Bayesian fine-mapping to identify credible sets of causal variants

    This approach has successfully identified over 100,000 single nucleotide variants associated with chromatin accessibility variability, with more than 22,000 fine-mapped at cell-type resolution . The high mapping resolution in maize makes it an exceptional system for discovering the genetic basis of regulatory variation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.