Recombinant Zea mays Cell number regulator 3 (CNR3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes if different. We will accommodate requests whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped standard with blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its use.
Synonyms
CNR3; Cell number regulator 3; ZmCNR03
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
CNR3
Target Protein Sequence
MYPATTPYETASGVGVAPVAGLFPVAGEAREWSSRLLDCFDDFDICCMTFWCPCITFGRT AEIVDHGMTSCGTSAALFALIQWLSGSQCTWAFSCTYRTRLRAQHGLPEAPCADFLVHLC CLHCALCQEYRELKARGYEPVLGWEFNAQRAAAGVAMCPPASQGMGR
Uniprot No.

Target Background

Database Links
Protein Families
Cornifelin family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed only in pollen.

Q&A

What is the Cell Number Regulator (CNR) gene family in Zea mays and how is CNR3 positioned within this family?

The Cell Number Regulator (CNR) gene family in maize consists of up to 13 members (CNR1-13) that function as regulators of cell number and subsequently affect plant and organ size. These genes were named based on their similarity to the tomato fruit weight gene fw2.2, with CNR1 and CNR2 being closest to the tomato ortholog . The CNR family represents an ancient eukaryotic family of Cys-rich proteins containing the PLAC8 or DUF614 conserved motif . Within this family, CNR3 is one of the 13 identified members that likely plays a role in cell proliferation control, though it has been less extensively characterized than CNR1.

All CNR family members except CNR11 and CNR12 have demonstrated expression evidence through cDNA and massively parallel signature sequencing (MPSS) tags . The gene structures for most of these family members have been elucidated, with CNR12 likely being non-functional as its genomic sequence indicates it would not encode a complete gene product .

What methods are recommended for isolating CNR3 genomic sequences from various maize populations?

For isolating CNR3 genomic sequences from maize populations, several methodologies used for other maize genes can be adapted:

  • Genomic DNA extraction: Use the cetyltrimethylammonium bromide (CTAB) method to extract high-quality genomic DNA from young maize leaves, as demonstrated in studies of other maize genes .

  • Target sequence capture: Employ targeted sequence capture technology on platforms like NimbleGen to resequence the CNR3 gene region across diverse maize lines. This approach was successful for genes like ZmSULTR3;4, allowing researchers to analyze polymorphisms in specific genomic regions .

  • Genotyping-by-sequencing (GBS): This method has been effectively used to genotype maize populations with large numbers of SNPs and can be applied to study CNR3 variants .

  • PCR amplification and sequencing: Design primers specific to the CNR3 genomic region for PCR amplification followed by Sanger sequencing to identify polymorphisms.

When studying CNR3 across diverse populations (e.g., teosintes, landraces, and inbred lines), researchers should consider analyzing not only the coding region but also upstream regulatory regions, UTRs, and downstream sequences to capture the full range of functional variation .

How should researchers approach CNR3 expression analysis in different maize tissues and developmental stages?

To effectively analyze CNR3 expression across maize tissues and developmental stages:

  • RNA extraction and quality control: Use specialized RNA extraction protocols for different maize tissues, especially considering that some tissues may contain high levels of polysaccharides or secondary metabolites that can interfere with RNA quality.

  • qRT-PCR analysis: Design gene-specific primers for CNR3 that do not amplify other CNR family members. Select appropriate reference genes for normalization based on stable expression across the tissues and conditions being studied.

  • RNA-seq approach: Implement RNA-seq to obtain a global view of gene expression, including CNR3, across different tissues and developmental stages. This approach has been used successfully to study gene expression patterns in maize .

  • In situ hybridization: For spatial expression analysis, develop CNR3-specific probes for in situ hybridization to localize expression at the cellular level within tissues.

  • Reporter gene constructs: Generate transgenic maize lines containing the CNR3 promoter fused to a reporter gene (e.g., GUS or GFP) to visualize expression patterns in vivo.

Based on studies of other CNR family members, researchers should pay particular attention to actively growing tissues where cell proliferation is occurring, as CNR genes have been associated with the regulation of cell number and organ size .

What experimental designs are most effective for investigating CNR3 function in relation to maize flowering time and adaptation?

To investigate CNR3 function in relation to maize flowering time and adaptation, the following experimental designs are recommended:

  • QTL mapping using biparental populations: Develop mapping populations such as recombinant inbred lines (RILs) between contrasting parental lines (e.g., temperate maize × tropical teosinte) to identify QTLs associated with flowering time variation. Near-isogenic lines (NILs) contrasting only at the CNR3 locus can also be developed to isolate CNR3 effects .

  • Association mapping: Conduct genome-wide association studies (GWAS) using diverse maize panels to identify associations between CNR3 genetic variants and flowering time phenotypes. Follow up with candidate gene-based association mapping focusing specifically on CNR3 .

Table 1: Experimental Design Elements for CNR3 Functional Studies

ApproachPopulation TypeSample Size RecommendationPhenotyping RequirementsStatistical Analysis
QTL MappingBiparental RILs200-900 linesDays to anthesis, silking timeStandard QTL analysis using mixed linear models
Association MappingDiverse inbred lines280+ linesFlowering time traits under multiple environmentsMLM with population structure (Q) and kinship (K) corrections
NIL ComparisonNear-isogenic lines10+ NIL pairsDetailed phenotyping with biological replicatesPaired t-tests, ANOVA
Multi-environment TestingAny of the above3+ environmentsConsistent protocols across locationsGxE interaction analysis
  • Transgenic approaches: Generate CNR3 overexpression and CRISPR-Cas9 knockout lines to directly test the effect of CNR3 on flowering time and plant development. These lines should be evaluated under different photoperiod conditions to assess adaptation responses .

  • Multi-environment testing: Evaluate mapping populations and transgenic materials across multiple environments representing different latitudes and day lengths to capture adaptation-related phenotypes .

  • Gene expression analyses: Compare CNR3 expression patterns between early and late flowering lines under different environmental conditions, particularly focusing on tissues known to be involved in flowering time regulation .

How can researchers effectively differentiate the functional roles of CNR3 from other CNR family members in maize development?

Differentiating the specific functions of CNR3 from other CNR family members requires a sophisticated experimental approach:

  • Sequence-based phylogenetic analysis: Conduct comprehensive phylogenetic analyses of the entire CNR gene family to understand evolutionary relationships and potential functional divergence or redundancy. This should include comparative analyses with CNR homologs from other species where functions have been characterized .

  • Expression correlation analysis: Perform co-expression network analyses to identify genes that are co-regulated with CNR3 versus other CNR family members. This can provide insights into the unique biological processes in which CNR3 participates .

  • Protein interaction studies: Conduct yeast two-hybrid screens or co-immunoprecipitation experiments to identify protein interaction partners specific to CNR3 versus other CNR family members.

  • CRISPR-Cas9 gene editing: Generate single and multiple gene knockouts within the CNR family to assess individual and redundant functions. Particularly informative would be comparing phenotypes of cnr3 single mutants versus double or triple mutants with other CNR genes .

  • Domain-specific functional analysis: Create chimeric proteins by swapping domains between CNR3 and other CNR family members to identify which protein domains confer functional specificity.

  • Tissue-specific expression manipulation: Use tissue-specific promoters to express or suppress CNR3 in specific tissues and compare outcomes with similar manipulations of other CNR family members.

  • Quantitative phenotyping: Implement high-throughput phenotyping methods to capture subtle differences in growth patterns, cell number, and organ size between CNR3 and other CNR gene manipulations .

What are the methodological challenges in purifying recombinant CNR3 protein and how can they be addressed?

Purification of recombinant CNR3 protein presents several methodological challenges that researchers should anticipate and address:

  • Protein solubility issues: CNR proteins are Cys-rich and may form insoluble aggregates when overexpressed in bacterial systems. To address this:

    • Use specialized E. coli strains designed for expressing difficult proteins (e.g., Rosetta, Arctic Express)

    • Optimize induction conditions (lower temperature, reduced IPTG concentration)

    • Consider fusion tags that enhance solubility (MBP, SUMO, or TRX tags)

    • Explore insect cell or mammalian expression systems if bacterial expression fails

  • Protein stability concerns: CNR proteins may exhibit poor stability during purification. Strategies include:

    • Include protease inhibitors throughout the purification process

    • Optimize buffer conditions (pH, salt concentration, reducing agents)

    • Consider adding stabilizing agents like glycerol or specific cofactors

    • Test different storage conditions to prevent degradation

  • Maintaining native folding: Ensuring proper folding of Cys-rich proteins:

    • Implement controlled oxidative refolding procedures if needed

    • Use size exclusion chromatography to isolate properly folded monomeric protein

    • Verify proper disulfide bond formation using mass spectrometry

  • Functional validation: Confirming that purified recombinant CNR3 retains its functional properties:

    • Develop in vitro activity assays specific to hypothesized CNR3 function

    • Compare structural properties with other characterized CNR family members

    • Verify protein-protein interactions with known or predicted partners

Table 2: Troubleshooting Guide for Recombinant CNR3 Protein Purification

ChallengePotential SolutionsSuccess Indicators
Insoluble proteinLower induction temperature (16-20°C), Reduce IPTG concentration (0.1-0.5 mM), Add solubility enhancers (sorbitol, glycerol)Increased protein in soluble fraction by Western blot
Protein degradationAdd protease inhibitor cocktail, Reduce purification time, Keep samples cold (4°C)Single band on SDS-PAGE
Poor yieldOptimize codon usage for expression system, Test different fusion tags (His, GST, MBP)Yield >1mg/L of culture
Improper foldingAdd reducing agents during lysis, controlled oxidation during refoldingConsistent elution profile on size exclusion chromatography

How does CNR3 expression respond to environmental stresses, and what methodologies are best for studying these responses?

Investigating CNR3 responses to environmental stresses requires robust methodological approaches:

  • Controlled stress experiments: Design experiments that impose specific stresses (drought, salt, heat, cold) under controlled conditions. Multiple intensity levels and time points should be included to capture both immediate and adaptive responses.

  • Expression analysis methods:

    • qRT-PCR for targeted expression analysis of CNR3 and related genes

    • RNA-seq for genome-wide expression changes and identification of co-regulated gene networks

    • Protein-level analysis using western blotting or proteomics approaches

  • Promoter analysis: Analyze the CNR3 promoter region for stress-responsive elements, comparable to studies of other stress-responsive genes like ZmSULTR3;4, which showed upregulation under salt stress .

  • Transgenic reporter systems: Develop transgenic lines containing the CNR3 promoter fused to a reporter gene (e.g., luciferase) to visualize real-time expression changes in response to stresses.

  • Comparative analysis across genetic diversity: Study CNR3 expression responses across diverse maize genotypes (landraces, inbred lines, teosinte) that have different stress tolerance levels to identify correlation between CNR3 expression patterns and stress adaptation .

Based on studies of other maize genes, it's important to note that different tissues may show distinct stress responses. For example, expression might be differentially regulated in roots versus leaves when exposed to the same stress .

What evolutionary patterns exist in CNR3 across maize and its wild relatives, and how should researchers investigate selection signatures?

To investigate evolutionary patterns and selection signatures in CNR3:

  • Sequence diversity analysis: Resequence CNR3 across diverse populations including:

    • Wild teosinte accessions (both Zea mays ssp. parviglumis and ssp. mexicana)

    • Maize landraces representing geographical diversity

    • Modern maize inbred lines

  • Nucleotide diversity metrics: Calculate key population genetics parameters:

    • Nucleotide diversity (π) within and between populations

    • Sequence conservation (C) across different gene regions

    • Tajima's D and Fu and Li's tests to detect selection signatures

  • Region-specific analysis: Separately analyze different functional regions of the gene:

    • Promoter/upstream regulatory region

    • 5'-UTR

    • Coding sequence (potentially by exon)

    • 3'-UTR

    • Downstream region

Table 3: Expected Patterns of Genetic Diversity in CNR3 Based on Other Maize Genes

Genetic ParameterTeosinteLandracesModern InbredsInterpretation
Nucleotide diversity (π × 1000)~20-25~8-10~5-6Reduction in diversity during domestication and improvement
Tajima's DVariableNegativeMore negativeSelection during domestication/improvement
Selective sweepsAbsentPartialCompleteProgressive selection during breeding
Haplotype diversityHighMediumLowReduction in genetic variation
  • Functional variant identification: Focus on polymorphisms associated with phenotypic variation to identify potentially functional variants under selection. Candidate gene-based association mapping can help identify these variants .

  • Geographic distribution analysis: Study the distribution of CNR3 alleles across geographical regions to identify adaptation patterns, similar to studies of other domestication-related genes .

  • Comparative analysis with CNR family: Compare selection patterns in CNR3 with other CNR family members to identify unique versus shared evolutionary trajectories .

Based on studies of other maize genes like ZmSULTR3;4, researchers should expect that if CNR3 has been under selection during domestication and improvement, there would be a reduction in nucleotide diversity from teosinte to landraces to modern inbreds, with particularly strong signals in regulatory regions .

What are the optimal vector systems and expression conditions for producing recombinant CNR3 protein?

For optimal production of recombinant CNR3 protein, consider the following vector systems and expression conditions:

  • Bacterial expression systems:

    • pET vector series (particularly pET28a with N-terminal His-tag) for high-level expression

    • pMAL-c2X for fusion with maltose-binding protein to enhance solubility

    • pGEX vectors for GST fusion to improve solubility and facilitate purification

    • pCold vectors for cold-shock induction that may improve folding of difficult proteins

  • Expression conditions optimization:

    • Test multiple E. coli strains: BL21(DE3), BL21(DE3)pLysS, Rosetta(DE3), Arctic Express

    • Induction temperature: 16-18°C is often optimal for Cys-rich proteins to reduce inclusion body formation

    • IPTG concentration: Test range from 0.1-1.0 mM, with lower concentrations often yielding more soluble protein

    • Induction time: Extended induction (16-24 hours) at lower temperatures may increase yield of soluble protein

    • Media composition: Enriched media (e.g., Terrific Broth) or auto-induction media can improve yields

  • Alternative expression systems if bacterial expression proves challenging:

    • Yeast systems (P. pastoris) for improved protein folding

    • Baculovirus-insect cell system for complex eukaryotic proteins

    • Plant-based expression systems, which may be particularly appropriate for plant proteins

  • Co-expression strategies:

    • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ) to improve folding

    • Co-express with thioredoxin or disulfide isomerase for proper disulfide bond formation in Cys-rich proteins

When designing the expression construct, it's advisable to include a cleavable tag to facilitate both purification and subsequent tag removal, as well as to consider codon optimization for the chosen expression system.

How should transgenic maize lines expressing modified CNR3 be designed and validated?

Designing and validating transgenic maize lines expressing modified CNR3 requires a comprehensive approach:

  • Construct design considerations:

    • Promoter selection: Use either native CNR3 promoter for endogenous expression pattern or constitutive promoters (e.g., ZmUbi) for overexpression

    • Consider tissue-specific promoters if targeting specific developmental processes

    • Include appropriate terminators (e.g., nos terminator) for proper transcription termination

    • Design epitope tags (FLAG, HA, GFP) that don't interfere with protein function

    • Include selectable markers appropriate for maize transformation (e.g., bar gene for bialaphos resistance)

  • Transformation methods:

    • Agrobacterium-mediated transformation of immature embryos from amenable genotypes (e.g., Hi-II)

    • Biolistic transformation as an alternative approach

    • Consider using maize inbred lines relevant to the research question rather than standard transformation genotypes where possible

  • Molecular validation steps:

    • PCR confirmation of transgene integration

    • Southern blot analysis to determine copy number and integration pattern

    • qRT-PCR to quantify expression levels of the transgene

    • Western blot analysis to confirm protein production using tag-specific antibodies

    • Confocal microscopy for visualizing tagged proteins in planta

  • Phenotypic validation:

    • Compare transgenic lines with non-transgenic controls for relevant traits (plant height, organ size, cell number)

    • Microscopic analysis of cells to directly assess effects on cell number and size

    • Field trials under multiple environments to assess broader phenotypic impacts

    • Compare results with predictions based on known functions of other CNR family members

  • Functional validation:

    • Complementation tests if working with cnr3 mutant backgrounds

    • Assess protein-protein interactions in planta through co-immunoprecipitation

    • Evaluate responses to relevant environmental conditions or stresses

When phenotyping transgenic lines, researchers should pay particular attention to traits related to cell number and organ size, as these are the expected functional domains of CNR genes based on studies of CNR1 .

What bioinformatic pipelines are recommended for analyzing CNR3 sequence variation across diverse maize populations?

For comprehensive analysis of CNR3 sequence variation across diverse maize populations, the following bioinformatic pipeline is recommended:

  • Sequence acquisition and quality control:

    • Filter raw sequencing data using tools like FastQC and Trimmomatic

    • Align sequences to reference genome using BWA-MEM or Bowtie2

    • Process alignments with SAMtools and GATK for quality refinement

  • Variant calling and filtering:

    • Call variants using GATK HaplotypeCaller or FreeBayes

    • Apply quality filters (depth, mapping quality, etc.)

    • Filter for minor allele frequency (MAF) ≥ 0.05 for population genetics analyses

  • Variant annotation and effect prediction:

    • Annotate variants using SnpEff or Ensembl VEP

    • Classify variants by genomic region (promoter, UTR, exonic, intronic)

    • Predict functional effects of coding variants

  • Population structure analysis:

    • Generate principal component analysis (PCA) plots using EIGENSOFT

    • Calculate population structure (Q) using STRUCTURE or ADMIXTURE

    • Build kinship matrix (K) for subsequent association analysis

  • Diversity and selection analysis:

    • Calculate nucleotide diversity (π) within populations using tools like TASSEL or DnaSP

    • Perform neutrality tests (Tajima's D, Fu and Li's tests) to detect selection signatures

    • Calculate FST to quantify differentiation between populations

  • Association analysis:

    • Perform candidate gene-based association tests using mixed linear models (MLM) that incorporate population structure (Q) and kinship (K)

    • Visualize associations using Manhattan and Q-Q plots

    • Correct for multiple testing using Bonferroni or FDR methods

Table 4: Software Tools for CNR3 Sequence Analysis Pipeline

Analysis StepRecommended ToolsKey Parameters/Considerations
Quality ControlFastQC, TrimmomaticQ-score cutoff ≥ 30, minimum length ≥ 50bp
Read AlignmentBWA-MEM, Bowtie2Use B73 reference genome, consider sensitivity settings
Variant CallingGATK HaplotypeCaller, FreeBayesMinimum depth ≥ 10, minimum quality ≥ 30
Population AnalysisSTRUCTURE, TASSEL, EIGENSOFTK-value determination, PCA component selection
Diversity AnalysisDnaSP, TASSELWindow size for sliding window analysis
Association TestingTASSEL, GAPITMLM with Q+K, significance threshold (1/n)
  • Haplotype analysis:

    • Construct haplotype networks using tools like PopART or Network

    • Calculate haplotype diversity within populations

    • Track haplotype frequencies across teosinte, landraces, and modern lines

This pipeline has been successfully applied to analyze sequence variation in other maize genes like ZmSULTR3;4 across diverse populations .

How does CNR3 fit into the network of genes regulating maize plant architecture and yield components?

Understanding CNR3's position within the broader regulatory network requires comprehensive investigation:

  • Co-expression network analysis: Construct gene co-expression networks using large-scale RNA-seq datasets across diverse tissues and conditions to identify genes that are consistently co-expressed with CNR3, suggesting functional relationships .

  • Protein-protein interaction mapping: Identify direct protein interaction partners of CNR3 through yeast two-hybrid screening or immunoprecipitation followed by mass spectrometry, which can reveal physical interaction networks.

  • Genetic interaction studies: Create double mutants between cnr3 and mutations in other cell cycle regulators or architecture-determining genes to identify epistatic or synergistic interactions.

  • Hormone signaling integration: Investigate how CNR3 interacts with major plant hormone pathways (auxin, cytokinin, brassinosteroids, gibberellins) that regulate cell division and expansion, as these are likely upstream or downstream regulators of CNR function .

  • Comparative analysis with QTLs: Align CNR3 genomic position with known QTLs for plant architecture and yield components to determine potential contributions to natural variation in these traits.

Based on studies of CNR1, which functions as a negative regulator of cell number and affects plant size , CNR3 may play a similar role in specific tissues or developmental contexts. Research suggests that genes like CNR1 could contribute to heterosis in maize, where F1 hybrid plants show increased height, leaf area, biomass, and yield compared to their inbred parents .

What are the most effective approaches for using CRISPR-Cas9 to study CNR3 function in maize?

Effective CRISPR-Cas9 approaches for studying CNR3 function in maize include:

  • sgRNA design considerations:

    • Target conserved functional domains to ensure complete loss-of-function

    • Design multiple sgRNAs to increase editing efficiency

    • Check for potential off-target sites using tools like Cas-OFFinder

    • Consider targeting non-coding regulatory regions for modified expression rather than complete knockout

  • Delivery methods for maize transformation:

    • Agrobacterium-mediated transformation of immature embryos

    • Biolistic delivery of CRISPR-Cas9 components

    • Ribonucleoprotein (RNP) delivery to reduce off-target effects and avoid transgene integration

  • Experimental design strategies:

    • Generate allelic series (null, hypomorphic, gain-of-function) to understand gene function

    • Create multiplex edits to target CNR3 alongside other CNR family members to address functional redundancy

    • Deploy inducible or tissue-specific CRISPR systems to study stage-specific functions

  • Screening and validation approaches:

    • High-throughput screening using T7 endonuclease I assay or next-generation sequencing

    • Detailed molecular characterization of edits using Sanger sequencing

    • Thorough phenotypic analysis comparing edited lines with wild-type controls

    • Complementation tests to confirm phenotype causality

  • Advanced CRISPR applications:

    • Base editing for introducing specific amino acid changes without double-strand breaks

    • Prime editing for precise nucleotide substitutions or small insertions/deletions

    • CRISPR activation/interference (CRISPRa/CRISPRi) to modulate CNR3 expression without altering sequence

How can researchers integrate CNR3 studies with investigations of maize adaptation to different environments?

Integrating CNR3 studies with maize environmental adaptation research requires a multi-faceted approach:

Understanding CNR3's role in environmental adaptation can build on research showing that genes controlling traits like flowering time have been important in maize adaptation across latitudes . Similar to how ZCN8 has undergone selection during maize adaptation to temperate environments , CNR3 may have experienced parallel selection in controlling growth and development aspects of environmental adaptation.

What are the most promising future research directions for CNR3 in maize improvement?

The most promising future research directions for CNR3 in maize improvement include:

  • Precision breeding applications: Utilize genomic selection and marker-assisted selection incorporating CNR3 alleles that optimize plant architecture and yield components. Similar to how CNR1 has been identified as potentially important for yield improvements , CNR3 variants could be selected for specific architectural traits.

  • Environmental resilience engineering: Identify and deploy CNR3 alleles that confer greater developmental stability under environmental stresses, focusing on maintaining optimal cell proliferation under adverse conditions.

  • Heterosis exploitation: Investigate how specific combinations of CNR3 alleles contribute to heterosis for plant size and yield, building on our understanding that CNR genes may be involved in the enhanced growth observed in hybrid maize .

  • Synthetic biology approaches: Design artificial CNR3 variants with modified regulatory or protein domains to achieve specific architectural outcomes beyond what exists in natural variation.

  • Integration with high-throughput phenotyping: Combine CNR3 genetic studies with cutting-edge phenomics approaches to capture subtle architectural and developmental effects across diverse environments.

  • Systems biology modeling: Develop predictive models that integrate CNR3 function within broader regulatory networks controlling plant growth and development, allowing for in silico prediction of phenotypic outcomes from genetic modifications.

Building on evidence that CNR family members function as negative regulators of cell number , exploring how modulation of CNR3 expression or activity could fine-tune organ development offers significant potential for crop improvement. The evolutionary conservation of CNR genes across eukaryotes suggests fundamental roles in cell proliferation control that could be leveraged for agricultural innovation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.