Recombinant Zea mays Cell number regulator 4 (CNR4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CNR4; Cell number regulator 4; ZmCNR04
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
CNR4
Target Protein Sequence
MSTYPPPTGEWTTGLCGCFSDCKSCCLSFLCPCIPFGQVAEVLDKGMTSCGLAGLLYCLL LHAGVAVVPCHCIYTCTYRRKLRAAYDLPPEPCADCCVHMWCGPCAISQMYRELKNRGAD PAMGRQPAFSLSLTSHCRFFLKSKYYHIIKKNWRTVKYG
Uniprot No.

Target Background

Database Links

KEGG: zma:100500711

UniGene: Zm.122127

Protein Families
Cornifelin family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in roots, coleoptiles, leaves, stalks, apical meristems, immature ears, endosperm, pericarp and tassel spikelets.

Q&A

What is the role of Cell Number Regulator 4 in maize leaf development?

Cell Number Regulator 4 (CNR4) is implicated in the early regulation of maize leaf development, particularly in the formation of specialized leaf anatomy. Based on transcriptome analyses, CNR4 appears to function within the regulatory network controlling cell differentiation in maize leaves. In C4 plants like maize, the specialized Kranz anatomy consists of bundle sheath (BS) cells surrounding veins and an outer layer of mesophyll (M) cells. This anatomical arrangement is crucial for the superior photosynthetic efficiency of C4 plants compared to C3 plants .

Gene regulatory networks controlling this development involve multiple transcription factors and developmental regulators that coordinate cell-type specification during early leaf development. Research using laser capture microdissection and transcriptome analysis has revealed distinct expression patterns in pre-BS and pre-M cells during development, suggesting that CNR4 may participate in these early differentiation processes .

How do researchers isolate and identify CNR-related proteins in maize?

Researchers typically employ several complementary approaches to isolate and identify CNR-related proteins:

  • RNA extraction and cDNA library construction: Total RNA is extracted from tissue samples (such as maize leaf pericarp tissues) using specialized kits like RNAeasy Plant Mini Kit. Oligo dT-primed cDNAs are then generated using systems such as the "Make Your Own 'Mate & Plate' Library System" .

  • Protein isolation and characterization: For protein-level analysis, leaf tissues are collected, ground in liquid nitrogen, and resuspended in extraction buffer containing various concentrations of NaCl (0, 100, or 400 mM). After centrifugation to remove insoluble debris, the supernatant containing proteins of interest is collected .

  • Affinity purification: Zinc-affinity pull-down assays can be performed to isolate zinc finger-containing proteins like CNRs. This involves incubating protein samples with zinc chelate affinity resin pre-equilibrated with extraction buffer, followed by washing steps and elution .

  • Western blot confirmation: After isolation, proteins are typically analyzed by SDS-PAGE and western blotting using specific antibodies to confirm identity .

What experimental systems are used to study CNR function in plants?

Several experimental systems are employed to investigate CNR function in plants:

  • Virus-mediated transient expression: Recombinant plant viruses (such as Potato virus X, PVX) can be used to express wild-type or mutant forms of CNR proteins fused to reporter genes like GFP. This approach allows for rapid assessment of protein function in planta without the need for stable transformation .

  • Virus-induced gene complementation (VIGC): This technique is particularly valuable for studying gene function in mutant backgrounds. For example, expression of wild-type CNR in cnr mutant fruits can partially restore ripening, allowing researchers to assess functional complementation .

  • Subcellular localization studies: Confocal microscopy is used to examine the subcellular localization of fluorescently-tagged CNR proteins, helping to determine their site of action within the cell .

  • Yeast-based assays: Yeast two-hybrid systems are employed to identify protein-protein interactions. For instance, bait constructs containing CNR coding sequences can be used to screen cDNA libraries to identify interacting partners .

How do functional domains contribute to CNR protein activity in maize?

The functionality of CNR proteins depends critically on specific structural domains that mediate their biological activity:

  • Nuclear Localization Signal (NLS): Experimental evidence indicates that a functional NLS is essential for CNR protein activity. Mutations in the NLS region prevent proper nuclear localization and abolish the protein's ability to influence developmental processes .

  • Zinc Finger Motifs (ZFMs): CNR proteins typically contain zinc finger domains that are crucial for their function. Studies have demonstrated that mutations in ZFMs eliminate the protein's ability to complement mutant phenotypes. For example, while wild-type CNR can partially restore ripening in CNR mutant fruits, ZFM-mutated versions fail to induce any ripening reversion .

  • SBP domain: In SBP-box gene family members like CNR, this domain is critical for DNA binding. The integrity of this domain is essential for proper transcriptional regulation of target genes .

These findings demonstrate that both nuclear localization and DNA-binding capabilities through zinc finger motifs are required for CNR proteins to perform their biological functions in regulating plant development.

What are the transcriptional networks regulated by CNR-like proteins in drought stress response?

CNR-like proteins participate in complex transcriptional networks that regulate drought stress responses in maize. While specific CNR4 data is limited, related transcription factors like ZmHDZ4 provide insights into these regulatory mechanisms:

  • Target gene regulation: Under drought stress conditions, homeodomain transcription factors in maize regulate the expression of specific target genes. For instance, ZmHDZ4 significantly represses the expression of genes including ZmMFS1-88, ZmGPM573, and ZmPHD9 under drought stress .

  • Physiological impact: Plants overexpressing regulators like ZmHDZ4 exhibit significantly higher relative water content and enhanced activities of protective enzymes such as peroxidase (POD) and superoxide dismutase (SOD) compared to wild-type plants when subjected to drought stress. Concurrently, these plants display lower malondialdehyde (MAD) content, indicating reduced oxidative damage .

  • Regulatory pathways: Transcription factors in the CNR and HD-ZIP families influence drought tolerance through multiple mechanisms including osmotic regulation, sugar metabolism pathways, and hormone signaling networks .

ParameterWild-typeOverexpression LinesSignificance
Relative water contentLowerHigherImproved water retention
POD activityBaselineSignificantly increasedEnhanced ROS scavenging
SOD activityBaselineSignificantly increasedImproved stress protection
MAD contentHigherLowerReduced oxidative damage
Target gene expressionBaselineRepressedAltered stress response

How can gene coexpression network analysis reveal CNR function in cell differentiation?

Gene coexpression network analysis is a powerful approach to uncovering the functional roles of CNR and related proteins in cell differentiation:

  • Identification of coexpression modules: Transcriptome data from different cell types and developmental stages can be analyzed to identify groups of genes with similar expression patterns (modules). These modules often represent genes involved in related biological processes or regulated by common factors .

  • Cell-type specific patterns: Analysis of transcriptomes from pre-bundle sheath (pre-BS) and pre-mesophyll (pre-M) cells reveals distinct coexpression modules associated with each cell type. Some modules correlate specifically with pre-Kranz cells, while others associate with pre-M cells, reflecting the different gene regulatory processes occurring in these distinct cellular compartments .

  • Temporal dynamics: Coexpression analysis can reveal temporal patterns in gene expression. For example, some genes show high expression at early developmental stages but become moderately expressed as development progresses, indicating stage-specific regulatory roles .

  • Regulatory inference: By combining differential gene expression analysis, coexpression network construction, and identification of transcription factor binding motifs, researchers can construct gene regulatory networks that include known regulators of specialized anatomical features like Kranz anatomy .

What are the best practices for designing recombinant CNR constructs for functional studies?

When designing recombinant CNR constructs for functional studies, researchers should consider several critical factors:

  • Selection of expression system: For plant proteins like CNR4, researchers can choose between bacterial expression systems (for biochemical studies), plant-based transient expression systems (for in vivo functional studies), or viral vectors for virus-induced gene expression .

  • Fusion tag selection: Reporter tags like GFP are commonly used for visualizing protein localization and expression. In existing research, GFP fusions with CNR proteins have successfully maintained protein functionality while enabling microscopic visualization .

  • Domain preservation: It's crucial to maintain the integrity of functional domains when designing constructs. Studies have shown that mutations in critical domains like nuclear localization signals (NLS) or zinc finger motifs (ZFMs) can completely abolish protein function .

  • Cloning strategy:

    • For yeast two-hybrid studies, coding sequences can be cloned into vectors like pGBKT7

    • For virus-mediated expression, genes can be cloned into modified viral vectors

    • Appropriate restriction sites (such as EcoRI/BamHI) should be incorporated for directional cloning

  • Validation strategy: Include appropriate controls to validate expression and function, such as:

    • Western blot analysis using antibodies against the protein or tag

    • RT-PCR confirmation of transcript expression

    • Functional complementation assays in mutant backgrounds

How can laser capture microdissection be optimized for studying cell-specific CNR expression?

Laser capture microdissection (LCM) is a valuable technique for isolating specific cell types for subsequent molecular analysis:

  • Sample preparation: Proper fixation and embedding of plant tissue samples is critical. Tissues should be fixed in a manner that preserves RNA and protein integrity while maintaining cellular morphology for accurate identification of target cells .

  • Cell type identification: For studying CNR expression in maize leaves, researchers need to clearly identify pre-bundle sheath (pre-BS) and pre-mesophyll (pre-M) cells based on their position and morphological characteristics. This requires expertise in maize leaf anatomy and development .

  • Microdissection strategy: When studying developmental processes, it's important to capture cells at various developmental stages. Research has utilized samples from multiple stages (e.g., designated as mGM, PM, 2M, 3PM, etc.) to track cell-type specific transcriptional changes over time .

  • RNA extraction and quality control: After microdissection, RNA must be carefully extracted from the captured cells. Due to the small amount of starting material, specialized protocols for RNA extraction from microdissected samples should be employed, followed by rigorous quality assessment before transcriptome analysis .

  • Data normalization and analysis: For transcriptome studies, appropriate normalization methods should be applied to account for technical variability between samples. Differential expression analysis can then be performed to identify cell-type specific expression patterns .

What are effective methods for analyzing protein-DNA interactions of CNR transcription factors?

Several complementary approaches can be used to analyze protein-DNA interactions of transcription factors like CNR:

  • Zinc-affinity pull-down assays: This technique leverages the zinc-binding properties of transcription factors like CNR to isolate protein-DNA complexes. The assay can be performed under different salt concentrations (e.g., 0, 100, or 400 mM NaCl) to assess the strength and specificity of interactions .

  • Yeast one-hybrid systems: These can be used to detect interactions between a transcription factor (like CNR) and specific DNA sequences in vivo. The system involves expressing the transcription factor as a fusion with a reporter gene's activation domain and measuring activation when the factor binds to its target DNA sequence .

  • Electrophoretic mobility shift assay (EMSA): While not explicitly mentioned in the search results, EMSA is a standard technique for studying protein-DNA interactions that would be applicable to CNR research. It involves incubating purified transcription factors with labeled DNA fragments and observing shifts in migration patterns that indicate binding.

  • Chromatin immunoprecipitation (ChIP): This technique can identify genomic regions bound by transcription factors in vivo. It involves cross-linking proteins to DNA, fragmenting chromatin, immunoprecipitating the protein of interest along with bound DNA, and then identifying the DNA sequences through sequencing or PCR.

  • Transcriptional activation assays: Functional validation of binding sites can be performed using reporter gene assays, where putative binding sites are cloned upstream of reporter genes and the effect of transcription factor expression on reporter activity is measured .

How do maize CNR proteins compare functionally to CNR proteins in other crop species?

While the search results don't provide direct comparisons between maize CNR proteins and those in other species, we can draw some comparative insights:

  • Functional conservation: CNR proteins appear to serve as important transcriptional regulators across different plant species. In tomato, SlSPL-CNR (a member of the SBP-box gene family) plays crucial roles in fruit ripening, while in maize, CNR-like proteins are involved in developmental processes including leaf formation .

  • Structural requirements: Across species, CNR proteins require similar functional domains for their activity. For example, the nuclear localization signal (NLS) and zinc finger motifs (ZFMs) are essential for SlSPL-CNR function in tomato, suggesting conserved structural requirements across different plant CNR proteins .

  • Developmental roles: While maize CNR proteins appear to be involved in leaf development and cell differentiation, particularly in the formation of Kranz anatomy, tomato SlSPL-CNR is critical for fruit ripening processes. This indicates that while the basic molecular function might be conserved, these proteins have been adapted to regulate different developmental processes in different species .

  • Mutant phenotypes: Mutations in CNR genes lead to distinct phenotypes across species. In tomato, Cnr mutants exhibit a "colourless non-ripening" fruit phenotype, while in maize, alterations in CNR-like gene expression can affect leaf cell differentiation and organization .

What insights can cross-species transcriptome studies provide about CNR function?

Cross-species transcriptome studies can provide valuable insights into CNR function:

  • Identification of conserved targets: By comparing transcriptomes from different species, researchers can identify conserved target genes regulated by CNR proteins across plant lineages. This helps establish the core molecular functions of these transcription factors .

  • Species-specific adaptations: Transcriptome comparisons can reveal how CNR proteins have been adapted to regulate different developmental processes in different species. For instance, comparing gene expression changes in maize leaves versus tomato fruits can highlight both shared and divergent regulatory networks .

  • Evolutionary insights: Cross-species analysis can provide information about the evolution of CNR-mediated regulatory networks and how they have been modified during plant evolution, particularly in the context of C4 photosynthesis evolution in grasses like maize .

  • Functional prediction: Expression patterns of CNR genes and their putative targets across species can help predict their roles in unstudied contexts. For example, if a maize CNR shows similar expression patterns to characterized CNR genes in other species, this may suggest functional conservation .

  • Biochemical conservation: Comparative studies can reveal whether the fundamental molecular mechanisms (such as DNA binding specificity, protein-protein interactions, and post-translational modifications) are conserved across different plant CNR proteins .

How do drought tolerance mechanisms involving transcription factors differ between C3 and C4 plants?

The search results provide some insights into drought tolerance mechanisms in C4 plants like maize:

  • Anatomical contributions: C4 plants like maize have specialized Kranz anatomy with bundle sheath and mesophyll cells arranged in concentric layers around veins. This anatomy contributes to their superior photosynthetic efficiency compared to C3 plants, which may indirectly affect water use efficiency and drought tolerance .

  • Transcription factor activity: In maize, transcription factors like ZmHDZ4 (a Homeodomain-Leucine Zipper I protein) contribute to drought tolerance through multiple mechanisms. Plants overexpressing ZmHDZ4 show improved physiological responses to drought stress, including higher relative water content and enhanced antioxidant enzyme activities .

  • Molecular mechanisms: The molecular pathways regulated by transcription factors in response to drought involve:

    • Osmotic regulation

    • Sugar metabolism pathways

    • Hormone signaling networks

    • Antioxidant defense systems

  • Regulatory targets: Transcription factors like ZmHDZ4 regulate specific target genes under drought stress conditions, including ZmMFS1-88, ZmGPM573, and ZmPHD9. These genes likely participate in various aspects of drought response .

While the search results don't provide direct C3 versus C4 comparisons, they suggest that specialized transcription factors in C4 plants like maize have evolved to regulate both photosynthetic development and stress responses in a coordinated manner, potentially contributing to the adaptability of these plants to variable environmental conditions.

What are the emerging techniques for studying CNR function in maize developmental biology?

Several emerging approaches show promise for advancing our understanding of CNR function in maize:

  • Single-cell transcriptomics: While current research has utilized laser-capture microdissection to isolate specific cell types, single-cell RNA sequencing could provide even higher resolution insights into cell-type specific expression patterns during development .

  • CRISPR-Cas9 genome editing: Precise modification of CNR genes and their regulatory elements could help establish causal relationships between specific domains or regulatory sequences and phenotypic outcomes.

  • Spatial transcriptomics: These techniques preserve spatial information while analyzing gene expression, allowing researchers to correlate CNR expression with specific anatomical features during development.

  • Multi-omics integration: Combining transcriptomics with proteomics, metabolomics, and epigenomics data could provide a more comprehensive understanding of how CNR proteins function within broader regulatory networks .

  • Advanced imaging techniques: Combining fluorescent reporters with advanced microscopy could enable real-time visualization of CNR protein dynamics during development.

These emerging approaches could help resolve current knowledge gaps regarding the precise molecular mechanisms through which CNR proteins influence maize leaf development and stress responses.

How might CNR research contribute to developing drought-tolerant maize varieties?

Research on CNR and related transcription factors has significant potential for developing drought-tolerant maize varieties:

  • Marker-assisted selection: Identification of favorable alleles of CNR genes could enable marker-assisted selection in breeding programs aimed at improving drought tolerance.

  • Genetic engineering approaches: Targeted modification of CNR expression or activity could enhance drought tolerance. For example, research on ZmHDZ4 demonstrated that overexpression improved several drought tolerance parameters including relative water content and antioxidant enzyme activities .

  • Pathway engineering: Understanding the regulatory networks controlled by CNR proteins could enable more sophisticated engineering of drought response pathways rather than manipulating single genes.

  • Physiological impacts: CNR research provides insights into how transcription factors influence key physiological parameters under drought stress:

ParameterImpact of Transcription Factor ModificationAgricultural Relevance
Relative water contentImproved retentionBetter survival during water limitation
Antioxidant enzyme activityEnhanced protectionReduced cellular damage under stress
Malondialdehyde contentDecreased oxidative damageMaintained cellular integrity
Target gene regulationAltered metabolic responsesOptimized resource allocation
  • Interdisciplinary applications: Combining CNR research with agronomic and physiological studies could translate molecular insights into field-relevant improvements in drought tolerance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.