Recombinant Zea mays Cell number regulator 7 (CNR7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request, but will incur additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard protocol uses 50% glycerol; this may serve as a useful reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
CNR7; Cell number regulator 7; ZmCNR07
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
CNR7
Target Protein Sequence
MYPAKPTVATASEPVTGMAAPPVTGIPISSPGPAVAASQWSSGLCACFDDCGLCCMTCWC PCVTFGRIAEVVDRGATSCAAAGAIYTLLACFTGFQCHWIYSCTYRSKMRAQLGLPDVGC CDCCVHFCCEPCALCQQYRELRARGLDPALGWDVNAQKAANNNAGAGMTMYPPTAQGMGR
Uniprot No.

Target Background

Database Links
Protein Families
Cornifelin family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in roots, leaves, immature ears and silks. Detected preferentially in silks.

Q&A

What is CNR7 and how does it relate to other CNR family members in maize?

CNR7 (Cell Number Regulator 7) is a member of the larger CNR gene family in maize (Zea mays) that consists of up to 13 members (CNR1-13). These genes are the maize orthologs of the tomato fw2.2 gene family that regulates fruit size primarily through cell number determination. CNR7 is characterized as a 180-amino acid protein encoded by a gene located on chromosome bin 1.11 (BAC AC190780) with the accession number HM008659 .

The CNR gene family in maize represents an ancient eukaryotic family of Cysteine-rich proteins containing the PLAC8 or DUF614 conserved motif. While CNR1 has been identified as the closest ortholog to the tomato fw2.2 gene and has been shown to function as a negative regulator of cell number affecting plant size, the specific functional role of CNR7 remains less characterized compared to CNR1 and CNR2 .

What is the genomic structure and evolutionary context of CNR7?

CNR7 belongs to the PLAC8 superfamily of proteins that has members across various eukaryotic organisms. Within the maize genome, CNR7 is positioned on chromosome 1, specifically at bin location 1.11. The gene structure includes conserved intron locations typical of the CNR gene family.

From an evolutionary perspective, CNR genes in maize form part of a plant-specific superclade within the larger PLAC8 protein family. Phylogenetic analyses have shown that different CNR family members cluster into distinct subclades, with CNR1 being most closely related to the tomato fw2.2 gene (57.6% similarity/47.1% identity), followed by CNR2 (60.2% similarity/50.8% identity) . While the specific subclade of CNR7 is not explicitly detailed in the available research, it forms part of this larger evolutionary family that includes proteins involved in cadmium resistance and calcium influx regulation in plants.

What expression patterns does CNR7 exhibit in maize tissues?

As a general pattern for the CNR family, expression is often associated with actively growing tissues where cell division and expansion are occurring. For instance, CNR1 has been shown to be expressed in regions with high growth activity and is correlated with tissue growth patterns. Similar dynamic expression patterns might be expected for CNR7, but tissue-specific expression data would be required to confirm this hypothesis.

What methodological approaches are optimal for producing recombinant CNR7 protein for functional studies?

Production of recombinant CNR7 protein requires careful consideration of expression systems, purification strategies, and functional validation methods. Based on current molecular biology techniques, the following approaches are recommended:

Expression Systems:

  • Bacterial expression (E. coli): Best for initial high-yield production, using vectors such as pET series with an N-terminal His-tag for purification.

  • Yeast expression (P. pastoris): If post-translational modifications are critical for CNR7 function.

  • Plant-based expression: For most authentic modification patterns, consider transient expression in Nicotiana benthamiana or stable transformation in Arabidopsis.

Purification Strategy:

  • Cell lysis using appropriate buffers that maintain protein stability

  • Affinity chromatography using His-tag or other fusion tags

  • Size exclusion chromatography for higher purity

  • Ion-exchange chromatography for final polishing

Validation Methods:

  • Western blot analysis using custom antibodies against CNR7

  • Mass spectrometry to confirm protein identity and modifications

  • Circular dichroism to evaluate secondary structure

  • Functional assays based on predicted activity (cell proliferation assays)

How can CRISPR-Cas technology be optimized for studying CNR7 function in maize?

CRISPR-Cas technology offers powerful approaches to investigate CNR7 function through targeted mutagenesis or precise gene editing. Based on recent advances in maize CRISPR applications, the following strategies are recommended:

Guide RNA Design for CNR7:

  • Select target sites within conserved domains or functional regions

  • Use tools like Cas-OFFinder to minimize off-target effects

  • Design gRNAs with appropriate GC content (40-60%) and minimal secondary structure

  • Validate gRNA efficiency in maize protoplasts before plant transformation

Delivery Methods:

  • Agrobacterium-mediated transformation (most common approach)

  • Particle bombardment with either DNA constructs or ribonucleoprotein complexes

  • Potential for transient delivery to maize egg and zygote cells for specific applications

Editing Strategies:

  • Knockout studies: Complete gene disruption to assess loss-of-function phenotypes

  • Base editing: For precise nucleotide changes without double-strand breaks

  • Prime editing: For targeted insertions, deletions, or specific base substitutions

  • Transcriptional modulation: Using dCas9 fusions to activate or repress CNR7 expression

Phenotypic Analysis:
Focus on measurements related to:

  • Cell number and size in various tissues

  • Plant height and biomass production

  • Organ size variations

  • Growth rates during development

What are the current technological limitations in studying CNR7 protein interactions and signaling networks?

Several technological challenges exist in fully characterizing CNR7 protein interactions and signaling pathways:

Protein-Protein Interaction Detection:

  • Specificity issues: CNR proteins may have transient or context-dependent interactions

  • In planta validation: Confirming interactions identified in heterologous systems

  • Membrane localization: If CNR7 is membrane-associated like other family members, this complicates traditional interaction assays

Signaling Pathway Elucidation:

  • Redundancy: Potential functional overlap with other CNR family members

  • Tissue specificity: Need for tissue-specific or cell-type-specific analysis methods

  • Temporal dynamics: Capturing signaling events that may be transient or developmental stage-specific

Technical Approaches to Address These Limitations:

  • Proximity-dependent labeling approaches (BioID, TurboID)

  • Single-cell transcriptomics to capture cell-type-specific responses

  • Optogenetic or chemically-inducible systems for temporal control

  • Advanced imaging techniques like FRET-FLIM for in vivo interaction studies

How can researchers effectively design experiments to distinguish the specific function of CNR7 from other CNR family members?

Distinguishing the specific function of CNR7 from other CNR family members requires careful experimental design that addresses potential redundancy and overlapping functions:

Experimental Design Strategies:

  • Phylogenetic-guided approach:

    • Generate a comprehensive phylogenetic analysis of all 13 CNR genes

    • Identify the closest paralogs to CNR7

    • Design experiments that target both CNR7 and its closest relatives

  • Expression pattern analysis:

    • Perform detailed spatiotemporal expression mapping using techniques like:

      • RNA-seq across tissues and developmental stages

      • In situ hybridization for tissue-specific localization

      • Promoter-reporter fusions to visualize expression patterns

    • Compare CNR7 expression with other family members to identify unique patterns

  • Multiple mutant analysis:

    • Create single, double, and higher-order mutants using CRISPR-Cas9

    • Systematically combine cnr7 mutations with mutations in other family members

    • Measure phenotypic effects using quantitative traits like:

Phenotypic TraitWild Typecnr7 Single MutantDouble Mutant (cnr7/cnrX)Triple Mutant
Cell numberBaselineMeasure deviationTest for synergistic effectsComplete pathway disruption
Organ sizeBaselineMeasure deviationTest for synergistic effectsComplete pathway disruption
Growth rateBaselineMeasure deviationTest for synergistic effectsComplete pathway disruption
  • Domain-swap experiments:

    • Create chimeric proteins exchanging domains between CNR7 and other family members

    • Express these under the CNR7 promoter to test domain function specificity

    • Assess complementation efficiency in cnr7 mutant backgrounds

What are the best practices for quantifying CNR7's impact on cell proliferation and organ size in maize?

Accurate quantification of CNR7's impact on cell proliferation and organ size requires robust methodologies across multiple scales:

Cellular-Level Measurements:

  • Flow cytometry analysis:

    • Isolate nuclei from specific tissues

    • Measure cell cycle distribution and ploidy levels

    • Compare wild-type vs. cnr7 mutant tissues

  • Microscopy-based cell counting:

    • Use cleared tissue preparations with nuclear stains

    • Employ automated image analysis for unbiased counting

    • Measure cell size distributions and numbers per defined area

  • EdU/BrdU incorporation assays:

    • Pulse-label actively dividing cells

    • Quantify proliferation rates in specific tissues

    • Compare wild-type vs. cnr7 altered expression lines

Organ-Level Measurements:

  • High-throughput phenotyping platforms:

    • Use imaging systems to track growth non-destructively

    • Measure parameters like leaf area, stem diameter, and plant height

    • Apply growth modeling to quantify growth rates

  • Histological analysis workflow:

    • Fix tissue samples at defined developmental stages

    • Section and stain using standardized protocols

    • Measure cell number, size, and arrangement

Standardized Sampling Approach:

  • Collect samples at precisely defined developmental stages

  • Use multiple biological replicates (n≥10)

  • Control environmental conditions rigorously

  • Include appropriate reference genotypes

Data Analysis Pipeline:

  • Apply statistical methods suitable for growth data (e.g., growth curve analysis)

  • Use mixed models to account for environmental and genetic factors

  • Consider using principal component analysis for multivariate phenotype data

How can researchers effectively use heterologous expression systems to study CNR7 function?

Heterologous expression systems offer powerful approaches to study CNR7 function outside its native context:

System Selection Based on Research Question:

  • Bacterial systems (E. coli):

    • Best for: Protein production, structural studies, biochemical assays

    • Limitations: Lack of eukaryotic post-translational modifications

    • Optimization: Use codon-optimized sequences and appropriate fusion tags

  • Yeast systems (S. cerevisiae, P. pastoris):

    • Best for: Functional complementation, protein-protein interactions

    • Approach: Test if CNR7 can complement growth phenotypes in yeast mutants

    • Analysis: Measure growth rates, cell size, and division patterns

  • Plant cell cultures (BY-2, Arabidopsis):

    • Best for: Subcellular localization, protein dynamics

    • Techniques: Fluorescent protein fusions, inducible expression systems

    • Measurements: Cell division rates, cell size distribution

  • Heterologous plant systems (Arabidopsis, tobacco):

    • Best for: In planta function, developmental effects

    • Approaches: Constitutive or inducible expression of CNR7

    • Analysis: Compare organ size, cell number, and growth patterns

Experimental Design Considerations:

  • Controls:

    • Empty vector controls

    • Expression of other CNR family members for comparison

    • Mutated versions of CNR7 to identify critical residues

  • Expression verification methods:

    • Western blotting

    • RT-qPCR for transcript levels

    • Proteomic analysis

  • Functional readouts:

    • Cell cycle progression markers

    • Cell size measurements

    • Organ growth parameters

What are the recommended protocols for analyzing CNR7 expression patterns across different maize tissues and developmental stages?

Comprehensive analysis of CNR7 expression requires multiple complementary approaches:

RNA-Level Analysis:

  • RT-qPCR methodology:

    • Design primers specific to CNR7 (avoiding cross-amplification with other CNR genes)

    • Recommended reference genes: UBIQUITIN, ACTIN, GAPDH (use multiple references)

    • Sampling protocol: Collect tissues at defined developmental stages

    • Data analysis: Use ΔΔCt method with appropriate normalization

  • RNA-Seq approach:

    • Minimum coverage requirements: 20 million reads per sample

    • Biological replicates: n≥3

    • Analysis pipeline:

      • Alignment to B73 reference genome

      • Quantification using featureCounts or similar tools

      • Differential expression analysis with DESeq2 or edgeR

  • In situ hybridization:

    • Probe design: Target unique regions of CNR7 transcript

    • Use sense probes as negative controls

    • Tissue preparation: Paraffin embedding or cryosectioning

Protein-Level Analysis:

  • Custom antibody production:

    • Select peptide regions unique to CNR7

    • Validate antibody specificity against recombinant protein

    • Test cross-reactivity with other CNR family members

  • Western blot protocol:

    • Optimized extraction buffer for membrane-associated proteins

    • Recommended loading control: ACTIN or TUBULIN

    • Quantification method: Densitometry with normalization

  • Immunolocalization:

    • Tissue fixation: 4% paraformaldehyde for 12-24 hours

    • Antigen retrieval: Citrate buffer pH 6.0

    • Counter-staining: DAPI for nuclei visualization

Reporter Gene Strategies:

  • Promoter:GUS/GFP fusions:

    • Cloning at least 2kb of upstream sequence

    • Stable transformation into maize

    • Histochemical and fluorescence microscopy analysis

  • CRISPR-based transcriptional reporters:

    • dCas9-based visualization of endogenous CNR7 locus

    • Live imaging of expression dynamics

How can researchers integrate CNR7 functional data with broader maize growth regulatory networks?

Integrating CNR7 functional data into broader regulatory networks requires systematic data collection and computational approaches:

Multi-Omics Integration Strategies:

  • Transcriptome correlation networks:

    • Perform RNA-seq across tissues where CNR7 is expressed

    • Identify genes with correlated expression patterns

    • Construct co-expression networks using WGCNA or similar methods

  • Proteome interaction mapping:

    • Immunoprecipitation coupled with mass spectrometry (IP-MS)

    • Yeast two-hybrid screens with CNR7 as bait

    • Proximity labeling approaches (BioID) to capture transient interactions

  • Metabolome association:

    • Profile metabolites in CNR7 mutant vs. wild-type tissues

    • Identify metabolic pathways affected by CNR7 activity

    • Correlate metabolite levels with phenotypic changes

  • Chromatin structure and accessibility:

    • Evaluate whether CNR7 affects chromatin organization

    • Perform ATAC-seq or similar methods in CNR7 mutant backgrounds

Network Analysis Methods:

  • Pathway enrichment analysis:

    • Use tools like GSEA, AgriGO, or MapMan

    • Identify biological processes over-represented in differentially affected genes

  • Regulatory network inference:

    • Apply algorithms like GENIE3 or ARACNe

    • Predict regulatory relationships between CNR7 and other genes

  • Integration with existing maize networks:

    • Compare with known cell cycle regulatory networks

    • Evaluate overlap with developmental regulatory pathways

Visualization and Data Sharing:

Data TypeRecommended RepositoryFile FormatVisualization Tool
RNA-seqGene Expression Omnibus (GEO)FASTQ, BAMCytoscape, R packages
ProteomicsProteomeXchangemzMLSTRING, Cytoscape
PhenomicsDryad or custom databaseCSV, HDF5R packages, custom dashboards
GenomicsSequence Read Archive (SRA)FASTQ, VCFIGV, JBrowse

What statistical approaches are most appropriate for analyzing the phenotypic effects of CNR7 genetic variants?

The analysis of phenotypic effects from CNR7 genetic variants requires appropriate statistical methods:

Experimental Design Considerations:

  • Sample size determination:

    • Power analysis based on expected effect sizes

    • Minimum recommendation: n≥30 for field studies, n≥10 for controlled conditions

    • Account for genetic background variation

  • Control selection:

    • Near-isogenic lines differing only in CNR7 alleles

    • Multiple independent transgenic/mutant events

    • Appropriate wild-type controls from same genetic background

Statistical Methods by Experiment Type:

  • For comparing discrete genotypes (e.g., mutant vs. wild-type):

    • ANOVA followed by post-hoc tests (Tukey HSD for balanced designs)

    • Mixed-effects models when including random factors (environment, background)

    • Non-parametric alternatives (Mann-Whitney U test) for non-normal data

  • For quantitative trait association:

    • Linear regression models

    • GWAS approaches if evaluating natural variation

    • QTL mapping to position effects relative to other loci

  • For time-series data (growth measurements):

    • Repeated measures ANOVA

    • Growth curve modeling

    • Functional data analysis methods

Advanced Analytical Approaches:

  • Multivariate methods:

    • Principal Component Analysis for dimension reduction

    • Discriminant Analysis for genotype classification

    • Canonical Correlation Analysis for trait relationships

  • Machine learning approaches:

    • Random Forest for feature importance

    • Support Vector Machines for genotype prediction

    • Neural networks for complex trait predictions

  • Causal inference methods:

    • Structural equation modeling

    • Bayesian networks

    • Mendelian randomization (where applicable)

What emerging technologies could transform our understanding of CNR7 function in the coming years?

Several cutting-edge technologies hold promise for advancing CNR7 research:

Single-Cell Technologies:

  • Single-cell RNA-seq to map CNR7 expression at cellular resolution

  • Single-cell proteomics to detect cell-specific protein levels

  • Spatial transcriptomics to map expression in tissue context

Advanced Genome Engineering:

  • Base editing for precise nucleotide changes without double-strand breaks

  • Prime editing for targeted insertions and replacements

  • CRISPR activation/interference for modulating CNR7 expression without sequence changes

Imaging Innovations:

  • Super-resolution microscopy for subcellular localization

  • Light-sheet microscopy for whole-organ imaging

  • Live-cell imaging with genetically encoded biosensors

Computational Approaches:

  • Machine learning for phenotype prediction

  • Network inference algorithms for regulatory interactions

  • Protein structure prediction using AlphaFold2 and related tools

How might understanding CNR7 function contribute to breeding strategies for improved maize varieties?

Understanding CNR7 function could translate into practical breeding applications:

Potential Breeding Applications:

  • Yield improvement strategies:

    • Modulating CNR7 expression to optimize cell number in specific tissues

    • Fine-tuning organ size for optimal resource allocation

    • Enhancing plant architecture through strategic modification of growth patterns

  • Stress resilience enhancement:

    • If CNR7 is involved in growth regulation under stress conditions

    • Developing varieties with optimized growth responses to environmental challenges

    • Creating alleles that maintain yield stability across environments

  • Hybrid vigor contributions:

    • Exploring CNR7's potential role in heterosis mechanisms

    • Developing complementary alleles for hybrid breeding programs

    • Utilizing CNR7 expression as a predictive marker for hybrid performance

Implementation Approaches:

  • Marker-assisted selection:

    • Develop molecular markers for beneficial CNR7 alleles

    • Screen germplasm collections for natural variation

    • Incorporate CNR7 markers into breeding pipelines

  • Genome editing applications:

    • Precise modification of CNR7 coding or regulatory sequences

    • Creation of novel allelic series for phenotypic optimization

    • Deployment in elite germplasm with minimal disruption to genetic background

  • Expression modulation strategies:

    • Tissue-specific promoter modifications

    • Enhancer/repressor element engineering

    • RNA-based regulation approaches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.