Recombinant Zea mays Cell number regulator 8 (CNR8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
CNR8; SAT5; Cell number regulator 8; ZmCNR08
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
CNR8
Target Protein Sequence
MGAGANNHEESSPLIPAAVAAPAYEKPPQAPAPEAANYYADGVPVVMGEPVSAHAFGGVP RESWNSGILSCLGRNDEFCSSDVEVCLLGTVAPCVLYGSNVERLAAGQGTFANSCLPYTG LYLLGNSLFGWNCLAPWFSHPTRTAIRQRYNLEGSFEAFTRQCGCCGDLVEDEERREHLE AACDLATHYLCHPCALCQEGRELRRRVPHPGFNNGHSVFVMMPPMEQTMGRGM
Uniprot No.

Target Background

Database Links

STRING: 4577.GRMZM2G334628_P02

UniGene: Zm.19771

Protein Families
Cornifelin family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in roots, coleoptiles, leaves, stalks, apical meristems, immature ears, embryos, endosperm, pericarp, silks, tassel spikelets and pollen. Highest expression in the pericarp and stalks.

Q&A

What is the function of Cell number regulator 8 (CNR8) in Zea mays?

CNR8 likely plays a role in regulating cell proliferation and growth across various maize tissues, potentially affecting plant architecture and yield components. Similar to ARGOS8, which modulates ethylene responses and impacts drought tolerance, CNR8 may influence developmental processes by regulating cell division rates in specific tissues .

For robust functional characterization, researchers should implement a multi-faceted approach including:

  • Expression profiling across tissues and developmental stages using RT-qPCR

  • Generation and phenotypic characterization of loss-of-function and gain-of-function lines

  • Cellular imaging to quantify effects on cell number, size, and organization

  • Identification of molecular interaction partners through yeast two-hybrid or co-immunoprecipitation assays

  • Testing performance under various environmental conditions to assess context-dependent functions

How is CNR8 expression regulated in different maize tissues?

CNR8 expression is likely controlled through a complex regulatory network involving tissue-specific promoter elements, developmental timing signals, and environmental response pathways. Based on studies of other maize regulatory genes, several mechanisms may control CNR8 expression:

  • Promoter variation: Similar to ZCN8, where SNP-1245 in the promoter region significantly affects flowering time, CNR8 may contain regulatory elements that control its spatial and temporal expression patterns .

  • Epigenetic regulation: DNA methylation and histone modifications may create tissue-specific expression patterns.

  • Transcription factor networks: Specific transcription factor binding sites in the CNR8 promoter likely mediate developmental and environmental responses.

  • Post-transcriptional control: RNA stability and miRNA targeting could provide additional regulatory layers.

To characterize CNR8 expression comprehensively, researchers should:

  • Perform RT-qPCR across multiple tissues and developmental stages

  • Generate promoter-reporter constructs to visualize tissue-specific expression patterns

  • Analyze epigenetic marks at the CNR8 locus using bisulfite sequencing and ChIP-seq

  • Identify transcription factors that regulate CNR8 using yeast one-hybrid or ChIP experiments

What genomic resources are available for studying CNR8 in maize?

Maize has extensive genomic resources that can be leveraged for CNR8 research:

  • Reference genomes: The B73 maize genome (Zm-B73-REFERENCE-NAM-5.0) has been sequenced using PacBio long-read technology, along with 25 additional founder inbred lines representing maize diversity (temperate, tropical, sweet corn, and popcorn germplasm) .

  • Gene annotation resources: Comprehensive gene annotations produced with the CSHL gene pipeline developed under the NAM project provide functional context for CNR8 .

  • Genetic mapping populations:

    • Multiple maize-teosinte populations for evolutionary studies

    • Near-isogenic lines (NILs) for specific loci

    • Recombinant inbred line (RIL) populations with high-resolution genetic maps

  • Gene editing tools: Established CRISPR-Cas9 protocols have been successfully employed in maize to generate novel allelic variants with improved traits .

  • Expression atlases: Microarray and RNA-seq datasets covering various tissues, developmental stages, and environmental conditions .

For CNR8 studies, these resources allow comprehensive analysis from evolutionary history to functional characterization and improvement.

How does CNR8 compare structurally to other cell number regulators in maize?

While specific structural information about CNR8 is not directly available in the current literature, structural analysis of CNR8 in relation to other cell number regulators would involve:

  • Domain structure analysis: CNR8 likely contains conserved domains associated with cell cycle regulation, growth control, or hormone signaling pathways. Computational tools like InterPro, SMART, or Pfam can identify these domains.

  • Promoter architecture: Regulatory elements in the CNR8 promoter may share motifs with other growth regulators. For instance, the ARGOS8 promoter contains elements responsive to ethylene signaling, and its modification alters drought response .

  • Evolutionary relationships: Phylogenetic analysis can establish CNR8's relationship to other growth regulators within and beyond the maize genome.

  • Functional motifs: Post-translational modification sites, subcellular localization signals, and protein-protein interaction domains should be identified and compared with other regulators.

Researchers should perform comparative genomic analysis across the 26 diverse maize lines in the NAM project to identify sequence conservation patterns in CNR8 and related regulators .

What is known about the evolutionary conservation of CNR8 across grass species?

Evolutionary analysis of CNR8 would provide important context for its functional significance. A comprehensive approach would include:

  • Ortholog identification in related grasses: Starting with the maize B73 reference genome, researchers should identify CNR8 orthologs in other grass species like rice, sorghum, wheat, and Brachypodium .

  • Selection pressure analysis:

    • Calculate Ka/Ks ratios to determine selective constraints

    • Identify conserved versus rapidly evolving regions

    • Examine evidence of domestication selection during maize evolution from teosinte

  • Synteny analysis: Examine conservation of genomic context around CNR8 across grass species, considering maize's ancient tetraploidy event .

  • Expression pattern conservation: Compare tissue-specific expression patterns of CNR8 orthologs across grass species to identify conserved regulatory mechanisms.

  • Functional complementation: Test whether CNR8 orthologs from other grass species can rescue maize cnr8 mutant phenotypes.

This evolutionary perspective is particularly valuable considering maize's complex genomic history and domestication from teosinte.

What CRISPR-Cas9 strategies can be employed to generate CNR8 variants for functional studies?

Based on successful CRISPR-Cas9 applications in maize gene editing, several strategies can be employed to generate CNR8 variants:

  • Promoter modifications: Similar to approaches with ARGOS8, the native CNR8 promoter could be replaced or modified to alter expression patterns. For ARGOS8, researchers inserted the maize GOS2 promoter into the 5'-UTR or used it to replace the native promoter, resulting in elevated transcripts across tissues .

  • Coding sequence edits:

    • Knockout mutations through frameshift indels

    • Precise amino acid substitutions to alter protein function

    • Domain deletions to understand structure-function relationships

  • Regulatory element targeting:

    • Modification of enhancers or silencers

    • Alteration of transcription factor binding sites

    • Editing of UTRs affecting mRNA stability

StrategyDescriptionAdvantagesChallengesExample in Literature
Promoter replacementSubstituting native promoter with constitutive promoter (e.g., GOS2)Consistent expression across tissuesMay disrupt native regulation patternsARGOS8 variants with GOS2 promoter showed 5 bushels/acre yield increase under drought
Promoter insertionInserting additional promoter while maintaining native sequencePreserves some native regulation while boosting expressionComplex insertion can be technically challengingGOS2 promoter inserted into 5'-UTR of ARGOS8
Coding sequence knockoutCreating frameshift mutationsComplete loss-of-function for phenotype analysisMay be lethal if gene is essentialMultiple examples in maize and other crops
SNP editingPrecise modification of specific nucleotidesMimics natural variationRequires homology-directed repair; lower efficiencySNP-1245 in ZCN8 promoter influences flowering time

Methodological considerations include guide RNA design to minimize off-target effects, optimized delivery methods, and thorough screening and verification of edited events through sequencing.

How can CNR8 expression be quantified accurately across different developmental stages?

Accurate quantification of CNR8 expression requires rigorous methodology across developmental stages:

  • Sample collection considerations:

    • Precise developmental staging for consistent comparisons

    • Standardized sampling times to control for diurnal variation

    • Flash freezing in liquid nitrogen to preserve RNA integrity

    • Pooling of sufficient biological replicates (typically 10-20 plants per sample, with 3-4 independent biological replicates)

  • RNA extraction and quality control:

    • Optimized extraction protocols for different tissues (e.g., Trizol extraction followed by column purification)

    • RNA integrity assessment (RIN > 8)

    • DNase treatment to remove genomic DNA contamination

  • RT-qPCR optimization:

    • Careful primer design spanning exon-exon junctions

    • Multiple reference genes validated for stability across developmental stages using GeNorm method

    • Standard curves to ensure reaction efficiency between 90-110%

    • Technical replicates (typically 3) to assess measurement precision

  • Alternative approaches for genome-wide context:

    • Microarray analysis using established maize platforms

    • RNA-seq for comprehensive transcriptome profiling

    • Single-cell RNA-seq for tissue heterogeneity resolution

These approaches provide complementary information about CNR8 expression dynamics across development.

What phenotypic assays best capture CNR8 function in regulating cell number?

Effective phenotypic characterization of CNR8 function requires multi-scale approaches:

  • Cellular-level assays:

    • Flow cytometry to quantify cell size distributions and ploidy levels

    • Microscopic analysis of cell number and dimensions in developing tissues

    • EdU or BrdU incorporation assays to measure cell division rates

    • Live imaging with fluorescently tagged proteins to track division patterns

  • Organ-level phenotyping:

    • Leaf growth kinematic analysis (tracking cell division and expansion zones)

    • Root system architecture characterization

    • Meristem size and organization assessment

    • Ear and tassel development analysis

  • Whole-plant phenotyping:

    • High-throughput image-based phenotyping for growth parameters

    • Detailed measurements of plant architecture (height, stem diameter, leaf dimensions)

    • Biomass accumulation rates across developmental stages

    • Phenological transitions (similar to flowering time measurements for ZCN8)

  • Yield component analysis:

    • Ear architecture and development

    • Kernel number, size, and weight

    • Harvest index

    • Field performance under different environmental conditions (similar to ARGOS8 drought trials)

Table: Key Phenotypic Measurements for Evaluating CNR8 Function in Maize

Phenotype CategorySpecific MeasurementsRelationship to CNR8 FunctionMeasurement Methodology
Cellular parametersCell number per tissue, cell size, division rateDirect readout of CNR8 activityMicroscopy, flow cytometry, EdU labeling
Growth parametersPlant height, leaf dimensions, internode lengthIntegrated results of cellular activityManual measurements, automated imaging
Yield componentsEar length, kernel number, grain yieldEnd result of developmental regulationField trials with replicated designs
Stress responsesPerformance under drought, heat, nutrient limitationAdaptation to environmental challengesControlled stress experiments, field trials

How do environmental stresses modulate CNR8 expression and function?

Environmental stress response is a critical aspect of maize adaptation and yield stability. Based on studies of related regulatory genes:

  • Expression analysis under controlled stress conditions:

    • Drought stress gradients (similar to ARGOS8 studies, which showed improved yield under drought)

    • Heat stress at different developmental stages

    • Nutrient limitation scenarios

    • Combined stress treatments reflecting field conditions

  • Cis-regulatory element analysis:

    • Identification of stress-responsive elements in the CNR8 promoter (similar to analyses of ZCN8 promoter variants)

    • Reporter gene assays to validate element function

    • Analysis of chromatin accessibility changes under stress (ATAC-seq)

  • Transgenic approaches:

    • Testing stress response of CNR8 variants with modified promoters (similar to ARGOS8 variants with the GOS2 promoter)

    • Creating stress-inducible CNR8 expression lines

  • Field-based phenotyping:

    • Multi-location trials under varying environmental conditions

    • Precision phenotyping using sensor networks and imaging

    • Comparison of performance across different stress regimes

The ARGOS8 study demonstrates how targeted modifications of regulatory genes can enhance stress resilience without yield penalties under favorable conditions , providing a valuable model for CNR8 research.

What are the challenges in differentiating between direct and indirect targets of CNR8?

Identifying the direct molecular targets of regulatory factors like CNR8 presents several methodological challenges:

  • Discriminating direct binding events from secondary effects:

    • ChIP-seq can identify genome-wide binding sites but requires:

      • High-quality antibodies specific to CNR8

      • Appropriate controls for background binding

      • Optimization for crosslinking conditions

    • DNA-binding motif analysis to identify consensus sequences

    • Integration with chromatin accessibility data

  • Integrating binding data with functional outcomes:

    • Combining ChIP-seq with RNA-seq to correlate binding with expression changes

    • Time-course experiments to capture primary vs. secondary responses

    • Inducible systems to trigger rapid CNR8 activation and identify immediate targets

  • Network inference challenges:

    • Distinguishing correlation from causation

    • Accounting for feedback loops in regulatory networks

    • Capturing context-dependent interactions

  • Validation approaches:

    • Direct manipulation of putative binding sites using CRISPR-Cas9

    • Reporter gene assays to test functional significance of binding

    • Genetic interaction studies (e.g., double mutants)

The complex nature of plant regulatory networks often requires integration of multiple approaches to build confidence in direct target assignment.

How should experiments be designed to study CNR8 function in field versus controlled conditions?

Robust experimental design is critical for understanding CNR8 function across environments:

  • Field experiment considerations:

    • Multi-location trials to capture different environmental conditions

    • Randomized complete block design with sufficient replication (minimum 3-4 blocks)

    • Border rows to minimize edge effects

    • Detailed environmental monitoring (weather stations, soil moisture probes)

    • Multiple year trials to assess environmental stability

    • Appropriate statistical models accounting for spatial variation

  • Controlled environment design:

    • Precisely defined growth conditions (light intensity, photoperiod, temperature, humidity)

    • Randomized designs with rotation schedules to account for chamber effects

    • Detailed growth staging for precise developmental comparisons

    • Statistical power calculations to determine appropriate sample sizes

  • Bridging field and controlled environments:

    • Integration of high-precision phenotyping in both settings

    • Identification of key environmental variables driving phenotypic differences

    • Development of models to predict field performance from controlled environment data

  • Experimental controls:

    • Near-isogenic lines differing only at the CNR8 locus (similar to the NILs used for ZCN8)

    • Multiple independent transgenic events to control for positional effects

    • Appropriate wild-type and null segregant controls

The ARGOS8 study illustrates this approach by testing CRISPR-modified variants under both drought stress and well-watered field conditions to demonstrate yield improvement of five bushels per acre under stress with no yield penalty under favorable conditions .

What controls and replicates are necessary for CNR8 gene editing experiments?

Gene editing experiments require rigorous controls and replication strategies:

  • Essential controls for CRISPR-Cas9 experiments:

    • Non-transformed wild-type as baseline comparison

    • Cas9-only transformants without guide RNAs to control for Cas9 effects

    • Transformants with non-targeting guide RNAs to control for guide RNA effects

    • Multiple independent edited events with the same target modification

    • Edited lines backcrossed to wild-type to eliminate off-target effects

  • Replication considerations:

    • Multiple independent transgenic events (minimum 3-5) for each construct

    • Progeny testing across generations to confirm stable inheritance

    • Biological replicates across different environments or conditions

  • Molecular validation requirements:

    • PCR and sequencing to verify precise edits (as done for ARGOS8)

    • Expression analysis to confirm expected transcriptional changes

    • Whole genome sequencing to assess potential off-target modifications

  • Phenotypic evaluation controls:

    • Side-by-side comparison with wild-type under identical conditions

    • Inclusion of known mutants with similar phenotypes as reference points

    • Homozygous vs. heterozygous comparisons to assess dosage effects

The ARGOS8 study validated their CRISPR-Cas9 modifications through precise genomic DNA verification using PCR and sequencing, followed by transcript level quantification across tissues to confirm the expected expression patterns .

What are the best methods to create and validate CNR8 overexpression and knockout lines?

Creating well-characterized CNR8 genetic lines requires methodological rigor:

  • Knockout strategy options:

    • CRISPR-Cas9 targeting of coding exons for frameshift mutations

    • CRISPR-Cas9 deletion of entire coding regions for complete gene removal

    • Traditional transposon insertional mutants from maize genetic resources

    • RNAi for partial knockdown when complete knockout is lethal

  • Overexpression strategy options:

    • Constitutive expression using strong promoters (e.g., maize Ubiquitin1)

    • Native promoter enhancement (similar to ARGOS8 approach with GOS2 promoter)

    • Tissue-specific overexpression using selected promoters

    • Inducible systems for temporal control of expression

  • Molecular validation approaches:

    • Genomic PCR and sequencing to confirm modifications

    • RT-qPCR to quantify transcript levels across tissues using validated reference genes

    • Western blotting to verify protein expression (requires specific antibodies)

    • Immunolocalization to confirm subcellular localization

  • Phenotypic validation:

    • Detailed growth measurement under multiple conditions

    • Cell-level phenotyping to confirm cell number alterations

    • Complementation testing to verify gene function

    • Dosage response analysis with varying expression levels

The ARGOS8 study provides a valuable template, as they validated their variants through precise genomic DNA modification verification and confirmed elevated transcript levels relative to the native allele across all tissues tested .

How can RNA-seq experiments be optimized to identify CNR8-dependent gene networks?

RNA-seq experimental design for regulatory gene network analysis requires careful consideration:

  • Sample selection strategy:

    • Developmental time series to capture dynamic regulation

    • Multiple tissues to assess tissue-specific networks

    • Contrasting genotypes (wild-type vs. knockout vs. overexpression)

    • Environmental treatments to identify condition-dependent networks

  • Technical considerations:

    • RNA quality assessment (RIN > 8)

    • Sufficient sequencing depth (typically 20-30M reads per sample for maize)

    • Strand-specific library preparation to distinguish sense/antisense transcription

    • Inclusion of spike-in controls for normalization

    • Biological replicates (minimum 3, preferably 4-6)

  • Analytical approaches:

    • Differential expression analysis between genotypes

    • Time-course analysis to identify early vs. late responses

    • Co-expression network construction to identify gene modules

    • Integration with ChIP-seq data to distinguish direct targets

    • Gene Ontology and pathway enrichment analysis

Table: Recommended Methods for Gene Expression Analysis in Maize

TechniqueApplicationSample RequirementsData Analysis ApproachReference
RT-qPCRTargeted gene expression analysis3-4 biological replicates; 3 technical replicatesGeNorm method for reference gene selectionStudy compared maize F1-hybrid and inbred lines
MicroarrayGenome-wide expression profilingIndependent biological replicates; RNA integrity number >8Normalization; false discovery rate adjustmentSpotted maize cDNA microarray with 10,649 features
RNA-seqComprehensive transcriptome analysisHigh-quality mRNA; typically 3+ biological replicatesFPKM/TPM normalization; DESeq2/edgeR for differential expressionVarious maize transcriptome studies
ChIP-seqIdentification of protein-DNA interactionsCross-linked tissue samples; specific antibodiesPeak calling algorithms; motif enrichment analysisUsed to identify transcription factor binding sites

What imaging techniques are most suitable for quantifying CNR8-mediated phenotypic changes?

Advanced imaging approaches offer powerful tools for phenotypic characterization:

  • Cellular-level imaging:

    • Confocal microscopy for 3D cellular architecture

    • Light sheet microscopy for live imaging of development

    • Electron microscopy for ultrastructural analysis

    • Super-resolution techniques for protein localization

  • Tissue and organ-level imaging:

    • Optical projection tomography for 3D organ reconstruction

    • X-ray computed tomography for non-destructive internal structure analysis

    • MRI for water content and structural imaging

    • Hyperspectral imaging for physiological status assessment

  • Whole-plant phenotyping:

    • RGB imaging for growth and morphology

    • Thermal imaging for water status

    • Chlorophyll fluorescence imaging for photosynthetic efficiency

    • 3D laser scanning for architectural analysis

  • Field-based imaging:

    • Drone-based multispectral imaging

    • Ground-based phenotyping platforms

    • High-throughput field phenotyping systems

  • Image analysis pipelines:

    • Machine learning approaches for feature extraction

    • Automated segmentation algorithms

    • Time-series analysis for growth dynamics

    • Multi-scale integration of imaging data

These methods enable quantitative characterization of CNR8 effects from cellular to field scales, capturing the full spectrum of phenotypic consequences.

How should contradictory results in CNR8 phenotypic studies be reconciled?

Contradictory results are common in biological research and require methodical investigation:

  • Sources of experimental variability to consider:

    • Genetic background effects (same mutation may have different effects in different backgrounds)

    • Environmental interaction effects (results may differ across locations or seasons)

    • Developmental timing differences (sampling at slightly different stages)

    • Methodology variations (different measurement techniques or protocols)

    • Statistical power limitations (insufficient replication)

  • Reconciliation strategies:

    • Meta-analysis approaches to integrate across studies

    • Direct side-by-side comparison under identical conditions

    • Epistatic interaction analysis to identify background modifiers

    • Environmental response profiling across multiple conditions

    • Dose-response studies to identify threshold effects

  • Common reconciliation scenarios:

    • Laboratory vs. field discrepancies (controlled environment studies often don't translate directly to field)

    • Different genetic backgrounds showing variable phenotypes

    • Seemingly contradictory physiological measurements reflecting complex homeostatic responses

  • Methodological improvements:

    • Increased biological replication

    • Multi-environment testing

    • More precise developmental staging

    • Integration of multiple measurement approaches

Robust experimental design with sufficient controls and replication, as demonstrated in the ARGOS8 field studies , is essential for minimizing contradictory results.

What statistical approaches are most appropriate for analyzing CNR8 expression data?

Statistical analysis of gene expression requires approaches tailored to the specific experimental design:

  • For RT-qPCR data:

    • Efficiency-corrected ΔΔCt methods for relative quantification

    • ANOVA with post-hoc tests for comparing multiple genotypes or conditions

    • Mixed models to account for technical and biological variation

    • Reference gene stability assessment using GeNorm or NormFinder methods

  • For microarray data:

    • Background correction and normalization procedures

    • False discovery rate control for multiple testing (as used in F1-hybrid studies)

    • Linear models with empirical Bayes moderation (limma approach)

    • Principal component analysis for pattern identification

  • For RNA-seq data:

    • Read normalization approaches (TPM, RPKM, or variance-stabilizing transformations)

    • Negative binomial models for count data (DESeq2, edgeR)

    • Time-series analysis for developmental studies

    • Generalized linear mixed models for complex designs

  • Integration of multiple data types:

    • Correlation-based network approaches

    • Machine learning methods for pattern recognition

    • Bayesian network inference

    • Canonical correlation analysis for multi-omics integration

How can ChIP-seq data be used to identify direct binding targets of CNR8?

ChIP-seq provides genome-wide identification of protein-DNA interactions:

  • Experimental design considerations:

    • Antibody specificity validation (critical for success)

    • Appropriate controls (input DNA, IgG control, non-binding mutant)

    • Optimization of crosslinking and sonication conditions

    • Sufficient sequencing depth (typically 20-30M reads)

    • Biological replicates (minimum 2-3)

  • Data analysis pipeline:

    • Quality control and read mapping to reference genome

    • Peak calling algorithms (MACS2, GEM, etc.)

    • Irreproducible discovery rate (IDR) analysis between replicates

    • Comparison to control samples to identify specific binding

    • Motif enrichment analysis to define binding preferences

  • Integration with other data types:

    • Correlation with RNA-seq to link binding with expression changes

    • Accessibility data (ATAC-seq, DNase-seq) to assess chromatin context

    • Histone modification ChIP-seq to understand epigenetic environment

    • 3D chromatin organization (Hi-C) to identify long-range interactions

  • Validation approaches:

    • Targeted ChIP-qPCR for specific loci

    • Reporter gene assays with wildtype and mutated binding sites

    • CRISPR editing of binding sites to assess functional significance

    • In vitro binding assays (EMSA, DNA affinity purification)

This multi-layered approach allows for high-confidence identification of direct CNR8 targets and regulatory mechanisms.

What bioinformatic pipelines are recommended for CNR8 variant analysis?

Bioinformatic analysis of genetic variants requires specialized pipelines:

  • Variant calling from sequencing data:

    • Quality filtering and read alignment to the maize reference genome

    • Variant calling tools (GATK, FreeBayes, etc.)

    • Structural variant detection for larger rearrangements

    • Filtering strategies to minimize false positives

  • Variant annotation:

    • Genomic context (coding, intronic, regulatory regions)

    • Effect prediction (synonymous, missense, nonsense)

    • Conservation analysis across maize lines and related species

    • Regulatory potential assessment

  • Population genetics analysis:

    • Allele frequency calculation in diverse maize populations

    • Linkage disequilibrium mapping

    • Selection signature detection

    • Haplotype analysis

  • Functional impact prediction:

    • Protein structure modeling for coding variants

    • Transcription factor binding site analysis for promoter variants (similar to analysis of ZCN8 promoter SNP-1245)

    • RNA structure prediction for UTR variants

    • Splicing effect prediction for intronic variants

  • CRISPR edit analysis:

    • Off-target prediction and assessment

    • Edit efficiency quantification

    • Mosaicism detection in primary transformants

    • Inheritance pattern tracking across generations

These approaches can be applied to naturally occurring CNR8 variants or engineered variants created through gene editing approaches like those used for ARGOS8 .

How should CNR8 gene network models be validated experimentally?

Network model validation requires iterative experimentation:

  • Target gene validation approaches:

    • RT-qPCR confirmation of predicted expression changes

    • Chromatin immunoprecipitation to verify direct binding

    • Reporter gene assays for cis-regulatory elements

    • CRISPR editing of binding sites or target genes

  • Network topology validation:

    • Perturbation experiments (inducible overexpression or knockdown)

    • Time-course analysis to trace information flow

    • Double mutant analysis to test genetic interactions

    • Feedback loop verification through targeted interventions

  • Predictive power assessment:

    • Testing model predictions under novel conditions

    • Cross-validation approaches with holdout datasets

    • Comparison to independently generated datasets

    • Testing response to environmental perturbations

  • Multi-scale validation:

    • Linking molecular changes to cellular phenotypes

    • Connecting cellular changes to organ-level responses

    • Relating organ-level effects to whole-plant performance

    • Testing population-level predictions in diverse germplasm

  • Systems biology approaches:

    • Mathematical modeling of network dynamics

    • Sensitivity analysis to identify key regulatory points

    • Integration of metabolic and signaling networks

    • Multi-omics data integration for comprehensive validation

These rigorous validation approaches ensure that network models accurately capture CNR8 regulatory functions and can guide further experimental investigations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.