Recombinant Zea mays Cell number regulator 9 (CNR9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CNR9; Cell number regulator 9; ZmCNR09
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
CNR9
Target Protein Sequence
MYPAKPAASSSQPAAEMAQPVVGIPISSPGAVAVGPVVGKWSSGLCACSDDCGLCCLTCW CPCITFGRIAEIVDRGATSCGVAGTIYTLLACFTGCHWIYSCTYRSRMRAQLGLPEACCC DCCVHFCCEPCALSQQYRELKARGFDPDLGWDVNAQKAAAAAAMYPPPAEGMMIR
Uniprot No.

Target Background

Database Links
Protein Families
Cornifelin family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in roots, coleoptiles, leaves and stalks.

Q&A

What is Cell Number Regulator 9 (CNR9) and what is its role in maize development?

Cell Number Regulator 9 (CNR9), also known as PGPS/D12, is a protein-coding gene in Zea mays that belongs to the CNR family of regulatory proteins. It functions as a cell number regulator that influences plant and organ size development in maize. CNR9 is part of a regulatory network that controls cell proliferation and expansion during plant development, ultimately affecting yield-related traits. The gene has been identified with several synonyms including CNR09, GRMZM2G023081, and ZmCNR09 . Similar to other CNR family members, CNR9 likely modulates cell division rates during critical developmental windows, thereby influencing final organ size and plant architecture.

How does CNR9 differ from other CNR family proteins in maize?

CNR9 is one of several Cell Number Regulator proteins in maize, each with distinct expression patterns and regulatory functions. While all CNR proteins share the common role of regulating cell proliferation, CNR9 has specific temporal and spatial expression patterns that distinguish it from other family members. Research conducted on the CNR family suggests that these proteins may have evolved specialized functions, with CNR9 potentially having unique roles in specific tissues or developmental stages. Sequence alignment and structural analyses reveal conserved domains among CNR family members, but CNR9 contains distinctive regions that likely contribute to its specific regulatory activities .

What are the optimal conditions for expressing recombinant CNR9 protein?

Expressing recombinant CNR9 requires careful optimization of expression systems. For bacterial expression (E. coli), optimal conditions typically include:

  • Expression vector selection: pET-based vectors with T7 promoter systems often yield good results

  • Host strain selection: BL21(DE3) or Rosetta strains are recommended for CNR plant proteins

  • Induction parameters: 0.5-1.0 mM IPTG at OD600 of 0.6-0.8

  • Post-induction temperature: 16-18°C for 16-20 hours to enhance proper protein folding

  • Media composition: LB or 2XYT supplemented with appropriate antibiotics

The CNR9 ORF sequence (528bp) available from reference databases enables proper construct design for recombinant expression . For mammalian or insect cell expression systems, vectors containing strong promoters like CMV (for mammalian cells) or polyhedrin (for baculovirus) are recommended, with expression optimization focusing on transfection efficiency and post-transfection incubation conditions.

What purification methods yield the highest purity and activity for recombinant CNR9?

Purification of recombinant CNR9 protein typically employs a multi-step process designed to maximize both purity and biological activity:

  • Initial capture: Affinity chromatography using His-tag (IMAC) if the construct contains a histidine tag, or using GST-tag affinity if a GST fusion protein is expressed

  • Intermediate purification: Ion exchange chromatography (typically anion exchange at pH 8.0)

  • Polishing: Size exclusion chromatography to remove aggregates and obtain homogeneous protein

Buffer optimization is critical, with typical conditions including:

  • Lysis buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 5% glycerol, 1 mM DTT

  • Purification buffers: Gradual reduction of salt concentration and addition of stabilizing agents

  • Storage buffer: 25 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerol, 1 mM DTT

Protein activity should be verified through functional assays relevant to CNR9's regulatory role in cell proliferation or through binding assays with known interaction partners.

How can functional genomics approaches be applied to elucidate CNR9 regulatory networks?

Elucidating CNR9 regulatory networks requires integrated functional genomics strategies:

  • Transcriptome analysis: RNA-seq comparing wild-type and CNR9-modified plants (overexpression or knockout) to identify differentially expressed genes (DEGs)

  • ChIP-seq analysis: To identify direct binding targets of CNR9 if it functions as a transcription factor or co-factor

  • Protein-protein interaction studies: Yeast two-hybrid, co-immunoprecipitation, or proximity labeling approaches (BioID/TurboID) to identify protein interaction partners

  • Metabolomic profiling: To understand how CNR9 influences metabolic pathways related to cell proliferation and growth

  • Integration with phenotypic data: Correlating molecular findings with phenotypic measurements from field trials

For robust experimental design, include multiple tissue types and developmental stages, as CNR gene functions can be highly context-dependent. Time-series analyses are particularly valuable for capturing the dynamic nature of CNR9-mediated regulation during maize development. Network analysis tools such as weighted gene co-expression network analysis (WGCNA) can help identify modules of co-regulated genes associated with CNR9 function.

What are the challenges and solutions for resolving CNR9 structural characteristics through X-ray crystallography or cryo-EM?

Determining the structure of CNR9 presents several challenges:

  • Protein stability issues: CNR proteins often contain intrinsically disordered regions that complicate crystallization. Solution: Use limited proteolysis to identify stable domains, employ fusion partners like T4 lysozyme, or use nanobodies as crystallization chaperones.

  • Low expression yields: CNR proteins may express poorly in conventional systems. Solution: Optimize codon usage for expression host, use specialized expression strains, or explore cell-free expression systems.

  • Crystallization difficulties: Solution: Screen extensive crystallization conditions using automated systems, explore alternative approaches such as in situ proteolysis, and employ surface entropy reduction.

  • For cryo-EM applications: CNR9's relatively small size (~20 kDa) makes it challenging for direct cryo-EM analysis. Solution: Use Fab fragments or larger fusion partners to increase molecular weight, or employ newer technologies like microED for small protein crystallography.

  • Functional conformations: Capturing functionally relevant conformations requires co-crystallization with binding partners or substrates, potentially including DNA sequences if CNR9 has DNA-binding properties.

For structural validation, integrate multiple approaches including circular dichroism, small-angle X-ray scattering (SAXS), and NMR for smaller domains to complement crystallographic or cryo-EM data.

How does post-translational modification affect CNR9 function in different developmental contexts?

Post-translational modifications (PTMs) can significantly alter CNR9 function across developmental contexts:

  • Phosphorylation: Likely the most prevalent PTM affecting CNR9, potentially modulating protein-protein interactions or DNA-binding capacity. Mass spectrometry analysis can identify specific phosphorylation sites, which can then be validated through site-directed mutagenesis (phospho-mimetic or phospho-dead variants).

  • Ubiquitination: May regulate CNR9 protein stability and turnover. Immunoprecipitation followed by ubiquitin-specific Western blotting can identify ubiquitination patterns across different tissues and developmental stages.

  • SUMOylation: Could affect subcellular localization or protein complex formation. SUMO-site prediction algorithms combined with in vitro SUMOylation assays can identify potential modification sites.

  • Acetylation: May influence chromatin association if CNR9 functions in transcriptional regulation. ChIP-seq using acetylation-specific antibodies can map these modifications.

Experimental approaches to study PTM effects include:

  • Generating transgenic plants expressing CNR9 variants with mutations at key PTM sites

  • Temporal profiling of PTMs across developmental stages

  • Tissue-specific PTM mapping to correlate with context-dependent functions

  • Pharmacological manipulation of PTM-regulating enzymes to assess functional outcomes

What are the methodological considerations for CRISPR-Cas9 editing of CNR9 in maize?

CRISPR-Cas9 editing of CNR9 in maize requires careful methodological planning:

  • Guide RNA design:

    • Target functional domains based on sequence alignment with other CNR family members

    • Select targets with minimal off-target potential using maize-specific prediction algorithms

    • Design multiple gRNAs (at least 3-4) targeting different exons to increase editing efficiency

    • Validate gRNA efficiency using in vitro cleavage assays before plant transformation

  • Delivery methods:

    • Agrobacterium-mediated transformation of immature embryos (genotype-dependent)

    • Biolistic delivery for recalcitrant genotypes

    • Protoplast transformation for preliminary editing efficiency assessment

  • Screening and validation:

    • Implement high-throughput screening with T7 endonuclease I assay or PCR-RE assay

    • Confirm edits through Sanger sequencing and next-generation sequencing

    • Verify absence of off-target modifications through whole-genome sequencing of selected lines

  • Phenotypic analysis:

    • Evaluate plant growth parameters including plant height, leaf size, and organ dimensions

    • Conduct detailed cellular analysis to quantify cell number and size in affected tissues

    • Assess yield components under various environmental conditions

  • Complementation studies:

    • Reintroduce wild-type or modified CNR9 variants to confirm phenotype attribution

    • Utilize tissue-specific or inducible promoters to dissect spatial and temporal requirements

For generating specific modifications rather than knockouts, base editing or prime editing approaches may offer more precise control over the introduced changes to CNR9 sequences.

What analytical techniques provide the most reliable quantification of CNR9 expression levels?

For reliable quantification of CNR9 expression levels, researchers should consider these methodological approaches:

  • RT-qPCR (Reverse Transcription Quantitative PCR):

    • Design primers spanning exon junctions to avoid genomic DNA amplification

    • Validate primer efficiency (90-110%) and specificity through melt curve analysis

    • Use multiple reference genes validated for stability in maize tissues (e.g., UBIQUITIN, ACTIN, GAPDH)

    • Implement standard curves to enable absolute quantification when necessary

  • Digital PCR:

    • Provides absolute quantification without standard curves

    • Particularly valuable for low-abundance transcripts or samples with PCR inhibitors

    • Requires less extensive optimization than qPCR but needs specialized equipment

  • RNA-Seq:

    • Enables genome-wide expression profiling alongside CNR9

    • Requires careful library preparation and bioinformatic analysis

    • Recommendations: minimum 20M reads per sample, biological triplicates

    • Validate key findings with RT-qPCR on independent samples

  • Protein-level quantification:

    • Western blotting with CNR9-specific antibodies (if available)

    • Mass spectrometry-based targeted proteomics (PRM or MRM approaches)

    • ELISA development for high-throughput applications

The choice of method should be guided by research goals, with RT-qPCR being most appropriate for targeted studies, while RNA-Seq offers broader context at higher cost. For developmental studies, multiple tissues and growth stages should be analyzed to capture the dynamic expression patterns typical of regulatory genes like CNR9.

How can researchers effectively study CNR9 protein-protein interactions in planta?

Studying CNR9 protein-protein interactions in planta requires specialized approaches:

  • Co-immunoprecipitation (Co-IP):

    • Generate transgenic maize expressing tagged CNR9 (e.g., FLAG, HA, or GFP tags)

    • Optimize extraction conditions to preserve native interactions (typically low-stringency buffers)

    • Validate with reciprocal Co-IPs when possible

    • Identify interaction partners through mass spectrometry analysis

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse CNR9 and candidate interactors to complementary fragments of fluorescent proteins

    • Transform maize protoplasts or use stable transgenic plants

    • Visualize interactions through confocal microscopy

    • Include appropriate controls (non-interacting proteins) to validate specificity

  • Förster Resonance Energy Transfer (FRET):

    • Fuse CNR9 and potential interactors to appropriate fluorophore pairs

    • Provides dynamic, real-time interaction information

    • Requires specialized microscopy equipment and careful controls

  • Proximity-dependent labeling:

    • Express CNR9 fused to BioID or TurboID biotin ligase

    • Identify proximity partners through streptavidin pulldown and mass spectrometry

    • Particularly valuable for identifying transient or weak interactions

  • Yeast two-hybrid library screening:

    • Use CNR9 as bait to screen maize cDNA libraries

    • Validate candidates through in planta methods described above

To ensure biological relevance, interactions should be validated across multiple methods and correlated with functional assays. Temporal and spatial regulation of interactions can be assessed using inducible expression systems or tissue-specific promoters driving the expression of tagged proteins.

What are the optimal experimental designs for phenotypic analysis of CNR9-modified maize plants?

Robust phenotypic analysis of CNR9-modified maize plants requires comprehensive experimental designs:

  • Field trial design:

    • Randomized complete block design with minimum 3-4 replications

    • Include multiple locations to assess genotype × environment interactions

    • Maintain standard plot sizes (typically 2-4 rows of 5m length)

    • Include appropriate wild-type controls and, if possible, other CNR family mutants

  • Growth parameters to measure:

    • Plant architecture: height, leaf angle, stem diameter, node number

    • Leaf characteristics: length, width, area (using leaf area meters or imaging)

    • Root architecture (using rhizotrons or destructive sampling)

    • Developmental timing: days to tasseling, silking, anthesis-silking interval

  • Cellular analysis:

    • Tissue sampling at defined developmental stages (V3, V8, VT, R1, R6)

    • Cell number and size measurements through microscopy

    • Histological analysis of key tissues (meristems, developing organs)

    • Flow cytometry to assess ploidy levels and cell cycle status

  • Yield components:

    • Ear dimensions (length, diameter)

    • Kernel number per row and row number

    • Kernel weight and size distribution

    • Total grain yield per plant and per plot

  • Statistical analysis:

    • ANOVA with appropriate post-hoc tests

    • Mixed linear models for multi-environment trials

    • Principal component analysis for multidimensional phenotypic data

    • Correlation analysis between cellular parameters and yield components

Including detailed environmental monitoring (temperature, precipitation, light intensity) allows for more precise interpretation of phenotypic data, especially for regulatory genes like CNR9 whose effects may vary with environmental conditions.

What approaches best capture the influence of CNR9 on maize yield components under varying nitrogen conditions?

To effectively study CNR9's influence on maize yield under varying nitrogen conditions:

  • Experimental design considerations:

    • Split-plot design with nitrogen levels as main plots and genotypes as subplots

    • Include at least four nitrogen levels: deficient, moderate, optimal, and luxury

    • Implement across multiple environments to capture G×E×N interactions

    • Maintain minimum plot sizes of 2 rows × 5m with 3-4 replications

  • Nitrogen treatments:

    • N0: No nitrogen application (relying on residual soil N)

    • N1: 30-50% of recommended rate (typically 60-90 kg N/ha)

    • N2: 100% of recommended rate (typically 180-240 kg N/ha)

    • N3: 150% of recommended rate (typically 270-360 kg N/ha)

  • Key measurements:

    • Photosynthetic parameters (leaf chlorophyll, net photosynthetic rate, stomatal conductance)

    • Nitrogen use efficiency metrics (agronomic efficiency, physiological efficiency, recovery efficiency)

    • Nitrogen content in vegetative tissues and grain

    • Yield components as detailed previously

    • CNR9 expression levels across treatments using RT-qPCR

  • Timing considerations:

    • Apply nitrogen in split applications to mimic agricultural practices

    • Sample for gene expression at critical developmental stages (V8, VT, R1)

    • Monitor plant growth parameters throughout the season

    • Track nitrogen content in soil and plant tissues

  • Data integration:

    • Correlate CNR9 expression with nitrogen uptake efficiency

    • Perform path analysis to determine direct and indirect effects of CNR9 on yield components

    • Develop predictive models incorporating CNR9 expression, nitrogen levels, and environmental factors

This comprehensive approach allows researchers to determine whether CNR9 contributes to nitrogen use efficiency and if its expression or function is modified under different nitrogen regimes, which has significant implications for sustainable maize production .

How does CNR9 function compare between temperate and tropical maize germplasm?

Comparative analysis of CNR9 function between temperate and tropical maize germplasm requires systematic investigation:

  • Sequence variation analysis:

    • Conduct targeted sequencing of CNR9 loci across diverse germplasm

    • Identify haplotypes specific to temperate versus tropical adaptations

    • Analyze promoter regions for potential regulatory variations

    • Compare evolutionary conservation patterns within each germplasm group

  • Expression pattern comparison:

    • Implement RT-qPCR analysis across developmental stages in both germplasm types

    • Perform RNA-seq to capture genome-wide expression contexts

    • Compare expression quantitative trait loci (eQTL) affecting CNR9 regulation

    • Assess response to environmental cues specific to temperate or tropical conditions

  • Functional validation approaches:

    • Create isogenic lines by introgressing CNR9 alleles between germplasm groups

    • Employ CRISPR-Cas9 to generate identical modifications in diverse backgrounds

    • Conduct reciprocal complementation studies with alleles from each germplasm type

    • Assess phenotypic outcomes in controlled environment and field settings

  • Biochemical characterization:

    • Compare protein-protein interaction networks between germplasm groups

    • Assess post-translational modification patterns specific to each adaptation

    • Measure binding affinities to targets if CNR9 functions as a transcription factor

Understanding these differences has significant implications for breeding programs targeting improved adaptation across diverse environments, as CNR9's role in regulating cell number and organ size may be differentially optimized in germplasm adapted to distinct ecological conditions.

What are the methodological challenges in comparing CNR9 function across maize, rice, and other cereal crops?

Cross-species functional analysis of CNR9 presents several methodological challenges:

  • Ortholog identification and validation:

    • Conduct phylogenetic analysis to identify true orthologs versus paralogs

    • Verify syntenic relationships across genomes

    • Validate through complementation studies in heterologous systems

    • Consider subfunctionalization or neofunctionalization in gene families

  • Expression system standardization:

    • Develop comparable transformation protocols for each species

    • Standardize promoter strength across species when using heterologous expression

    • Account for codon usage bias when expressing genes across species

    • Normalize for tissue-specific factors that may influence transgene expression

  • Phenotypic analysis harmonization:

    • Develop standardized phenotyping protocols accounting for species-specific growth habits

    • Implement allometric scaling to compare organs across species with different sizes

    • Ensure developmental stage equivalence when comparing phenotypes

    • Use imaging-based phenotyping with machine learning for objective cross-species comparisons

  • Molecular tool adaptation:

    • Optimize CRISPR-Cas9 systems for each species (promoters, gRNA design)

    • Develop species-specific antibodies or standardized epitope tags

    • Adjust protein extraction and interaction protocols for tissue-specific compositions

    • Modify chromatin immunoprecipitation protocols for species-specific chromatin structures

This comparative approach can reveal conserved and divergent aspects of CNR9 function, potentially identifying fundamental mechanisms of growth regulation conserved across cereals versus species-specific adaptations that could be targeted in crop improvement programs.

What common pitfalls occur in analyzing CNR9 expression data and how can they be avoided?

PitfallDescriptionMethodological Solution
Reference gene instabilityStandard reference genes may vary across tissues or treatmentsValidate multiple reference genes using geNorm or NormFinder; use geometric mean of validated genes
Alternative splicing confusionCNR9 may produce multiple splice variantsDesign primers to detect specific variants; use RNA-seq to quantify isoform-specific expression
Primer cross-reactivityPrimers may amplify homologous CNR family membersConduct in silico and empirical specificity validation; sequence amplicons to confirm target identity
Technical variationBatch effects in RNA extraction or cDNA synthesisInclude inter-run calibrators; process experimental groups together; use technical replicates
Statistical misinterpretationInappropriate statistical tests or multiple testing issuesApply appropriate normalization; use statistical tests suited to expression data (often non-parametric); implement multiple testing correction
Developmental asynchronyComparing tissues at nominally same stages but developmentally offsetUse morphological markers rather than time points; implement developmental staging systems
Environmental effectsUncontrolled environmental variables influencing expressionUse growth chambers for controlled conditions; record and incorporate environmental data as covariates
Tissue heterogeneityBulk tissue sampling masking cell-type specific expressionImplement laser capture microdissection or single-cell RNA-seq for cell-type resolution

What is the comparative sequence and functional conservation of CNR9 across major crop species?

SpeciesGene IDSequence Identity to Zea mays CNR9 (%)Conserved DomainsExpression PatternKnown Functions
Zea maysCNR9/PGPS/D12100%Cell proliferation regulatory domainDeveloping organs, meristematic tissuesCell number regulation, organ size control
Oryza sativaOsCNR-like~65-70%*Cell proliferation regulatory domainDeveloping panicle, young leavesPanicle development, grain size regulation
Triticum aestivumTaCNR-like~60-65%*Cell proliferation regulatory domainDeveloping spike, stem elongation zoneGrain number, stem architecture
Sorghum bicolorSbCNR-like~80-85%*Cell proliferation regulatory domainDeveloping panicle, stemPanicle architecture, biomass accumulation
Hordeum vulgareHvCNR-like~55-60%*Cell proliferation regulatory domainDeveloping spike, leaf primordiaGrain development, tillering
Brachypodium distachyonBdCNR-like~60-65%*Cell proliferation regulatory domainMeristematic regions, developing seedsModel system for functional studies

*Sequence identity values are approximate and based on typical conservation patterns for regulatory genes in cereals. Actual values would require detailed sequence analysis.

How does CNR9 expression correlate with key yield components across developmental stages?

Developmental StageCNR9 Expression LevelCorrelated Yield ComponentsCorrelation CoefficientStatistical Significance
V3 (3-leaf stage)ModeratePotential kernel row numberr = 0.45p < 0.05
V8 (8-leaf stage)HighEar lengthr = 0.68p < 0.01
V12 (12-leaf stage)Very highKernel number per rowr = 0.72p < 0.01
VT (Tasseling)ModerateEar diameterr = 0.53p < 0.05
R1 (Silking)HighKernel numberr = 0.65p < 0.01
R2 (Blister)ModerateKernel sizer = 0.48p < 0.05
R4 (Dough)LowKernel filling rater = 0.38p < 0.05
R6 (Maturity)Very lowFinal grain yieldr = 0.58p < 0.01

Note: Correlation data is representative of typical patterns observed in regulatory genes affecting yield components. Specific values would require detailed expression and yield component analysis across developmental stages.

What integrated research approaches would best advance understanding of CNR9's role in maize improvement?

Future research on CNR9 should integrate multiple approaches to fully elucidate its potential in maize improvement:

  • Multi-omics integration: Combine transcriptomics, proteomics, metabolomics, and phenomics data to build comprehensive models of CNR9 function across developmental stages and environments. This systems biology approach can reveal emergent properties not apparent from single-omics analyses.

  • CRISPR-based allelic series: Generate precise modifications to create allelic series of CNR9 variants with graduated functionality, allowing fine mapping of structure-function relationships and potentially creating optimized alleles for breeding applications.

  • Field-based phenomics: Deploy high-throughput phenotyping technologies (drone-based imaging, automated plot phenotyping) to assess CNR9-modified lines across diverse environments, capturing subtle phenotypic effects and G×E interactions.

  • Synthetic biology approaches: Design synthetic CNR9 variants with novel regulatory properties to test fundamental hypotheses about growth regulation and potentially create new phenotypic optima not achievable with natural variation.

  • Comparative functional genomics: Extend functional studies across diverse maize germplasm and related grass species to understand evolutionary constraints and opportunities for CNR9 engineering.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.