Recombinant Zea mays Chlorophyll a-b binding protein 1, chloroplastic (CAB1)

Shipped with Ice Packs
In Stock

Description

Introduction

The Chlorophyll a/b-binding (CAB) protein, specifically Recombinant Zea mays Chlorophyll a-b Binding Protein 1, chloroplastic (CAB1), is a critical component in the photosynthetic mechanism of plants. CAB1 is encoded by the CAB1 gene and is involved in the absorption of light energy, which is essential for photosynthesis . This article explores the function, mechanism, and regulation of CAB1, as well as its broader implications in plant biology.

Discovery and Background

The CAB gene, which encodes chlorophyll a/b-binding proteins, is one of the most extensively studied clock-regulated genes in plants . Steve Kay's discovery that CAB is regulated by a circadian clock revealed that the gene is activated in the morning and deactivated in the late afternoon . Klaus Kloppstech, a German botanist, found that transcripts of chlorophyll a/b binding protein (LHCB/CAB) in peas may be regulated by circadian rhythm. The fluctuation in the abundance of these transcripts corresponds to the circadian rhythm in peas. CAB, a subunit of ribulose-1,5-bisphosphate carboxylase/oxygenase, is induced by light .

Gene Information

FeatureDescription
Gene NameChlorophyll a-b binding protein 1, chloroplastic (CAB1)
OrganismZea mays (Maize)
Protein AccessionP12329
Amino Acid Range31-262
TagN-terminal His tag
Expression SystemE. coli

Function

The CAB protein plays a crucial role in capturing excitation energy required for photosynthetic mechanisms in plants . Upon exposure to light, the gene responsible for encoding this protein is rapidly induced. Studies have demonstrated that this gene triggers strong circadian rhythms in seedlings when exposed to continuous light . The proteins associate with chlorophyll and xanthophylls, aiding in sunlight absorption and energy transfer to photosystem II, which drives photosynthetic electron transport .

Mechanism

The circadian clock interacts with a specific phototransduction pathway involving the CAB2 promoter . Transcription factors that are under circadian control are implicated in one proposed mechanism. The -111 to -38 region sequence of the CAB promoter in Arabidopsis contains specific motifs, including a CCAAT box and three GATA motifs. These motifs' orientations and spacing are conserved in CAB promoters across many species. CAB GATA factor 1 (CGT-1), a protein, binds to the GATA repeats and promotes CAB2 production. A mutation that inhibits CGT-1 and GATA binding results in decreased CAB2 production .

Another proposed mechanism suggests that calcium ions regulate the CAB gene. According to the reciprocal control model, gene expression is upregulated in a calcium/calmodulin-dependent manner. Transcription levels are reduced via a cGMP-dependent pathway, which is under circadian control, resulting in a rhythmic flux of CAB expression that responds to light .

Specific CAB genes can be independently regulated via blue light input in addition to regulation via photochrome input. In Arabidopsis, CAB1 is regulated by a blue light system. Following exposure to blue light, CAB1 mRNA levels rise. Other gene subtypes, such as CAB2 and CAB3, are not regulated by blue light. There are distinct but related pathways involving blue light and phytochromes that influence CAB regulation .

CAB1 in Yeast

The pantothenate kinase Cab1 in yeast (Saccharomyces cerevisiae) is essential for cell viability and influences ergosterol metabolism and susceptibility to antifungal drugs . CAB1 encodes the only pantothenate kinase in S. cerevisiae. Cab1p activity modulation results in altered sterol levels and significant changes in yeast susceptibility to drugs that target late enzymes in ergosterol biosynthesis .

Mutants and Their Phenotypes

Mutant AllelePhenotype
cab1-G351SDecreased growth in medium containing FeSO4, increased iron content, reduced SDH and aconitase activity
cab1-N290IDecreased growth in medium containing FeSO4, increased iron content, reduced SDH and aconitase activity
cab1-S237NSevere reduction in oxidative growth at 37 °C
cab1-I294VMild reduction in oxidative growth at 37 °C
cab1-D144GWild-type oxidative growth at 37 °C

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CAB1; Chlorophyll a-b binding protein 1, chloroplastic; LHCII type I CAB-1; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
31-262
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
CAB1
Target Protein Sequence
RKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIH AQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKE LKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGN
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Database Links
Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Chlorophyll a-b binding protein 1 (CAB1) in Zea mays?

Chlorophyll a-b binding protein 1 (CAB1) in Zea mays is a critical component of the light-harvesting complex associated with photosystems in the chloroplast thylakoid membrane. The protein is encoded by the cab-1 gene, which contains extensive nucleotide homology within its protein coding region to CAB genes from other plant species. This gene is notably upregulated by light exposure, with transcripts accounting for approximately 2% of the mRNA in the leaves of light-grown seedlings compared to 0.4% in dark-grown seedlings . The protein functions primarily in capturing light energy and transferring it to photosynthetic reaction centers, playing a crucial role in the initial stages of photosynthesis.

How is the cab-1 gene structured in the maize genome?

The maize cab-1 gene has been isolated and characterized through genomic library screening. The gene's transcribed region has well-defined boundaries determined through S1 nuclease mapping. The 5' terminus of cab-1 mRNA is positioned 52-54 nucleotides upstream of the translation start site and 34 nucleotides downstream of a TATA box regulatory element . Like petunia CAB genes, the maize cab-1 gene contains several poly(A) addition sites in its mRNA. The 5' flanking DNA region contains sequences that resemble elements implicated in the light-regulated expression of CAB and rbcS genes observed in other plant systems, indicating evolutionary conservation of regulatory mechanisms across plant species .

What are the most effective methods for isolating the cab-1 gene from maize?

For isolating the cab-1 gene from maize, researchers have successfully employed a sequential approach involving:

  • mRNA Isolation: Extract mRNA from red-light irradiated maize seedlings to enrich for light-regulated transcripts.

  • cDNA Library Construction: Prepare a cDNA library using the isolated mRNA.

  • Differential Screening: Screen the library using a difference procedure to identify clones representing red-light regulated mRNA.

  • Secondary Genomic Screening: Use identified cDNA clones (such as pAB1084) as probes to screen a maize genomic library.

  • Clone Verification and Sequencing: Isolate positive genomic clones (like lambda AB1084) and perform sequencing to confirm identity .

This methodological approach allows for the identification and isolation of light-responsive genes like cab-1 and can be adapted for similar studies in other plant species.

How can researchers verify the expression levels of CAB1 in different experimental conditions?

Quantitative verification of CAB1 expression can be achieved through several complementary techniques:

  • Northern Blot Hybridization: Using gene-specific probes for cab-1, researchers can quantitatively analyze mRNA levels. This technique has shown that cab-1 transcripts represent about 0.4% of total mRNA in dark-grown seedlings and approximately 2% in light-grown seedlings .

  • Western Blot Analysis: Using anti-Lhca1 antibodies at recommended dilutions (1:2000-1:5000), researchers can detect CAB1 protein in plant extracts. Optimal results are achieved with 4-10 μg of total protein extracted from whole leaf samples .

  • Sample Preparation Protocol for Western Blotting:

    • Extract total protein from leaf tissue

    • Denature samples at 70°C for 5 minutes in LDS sample buffer

    • Separate proteins on 4-12% SDS-PAGE gels

    • Transfer to PVDF membranes (0.45 μm pore size)

    • Block with 5% milk in TBS-T overnight at 4°C

    • Incubate with primary antibody (1:1000 dilution)

    • Wash and incubate with secondary antibody (anti-rabbit IgG ALP conjugated, 1:1000)

    • Develop with BCIP-NBT-PLUS for approximately 30 seconds

This standardized protocol ensures reliable detection of CAB1 protein across different experimental conditions.

How does light influence CAB1 expression in maize?

Light plays a significant regulatory role in CAB1 expression in maize, though with distinct characteristics compared to other species:

  • Moderate Upregulation: White light exposure results in a 3- to 6-fold increase in cab-1 transcript levels, which is considered a moderate upregulation compared to some other light-responsive genes .

  • Red Light Responsiveness: The cab-1 gene is regulated by red light, as evidenced by its identification in mRNA from red-light irradiated maize seedlings .

  • Transcriptional Control: The 5' flanking DNA of cab-1 contains sequences related to elements implicated in light-regulated expression of CAB genes in other plant systems, suggesting conservation of regulatory mechanisms .

  • Baseline Expression: Interestingly, even in dark-grown seedlings, cab-1 mRNA represents up to 80% of the total CAB mRNA, indicating a significant baseline expression level even without light induction .

This light-dependent regulation allows maize to optimize its photosynthetic apparatus in response to changing light conditions, an essential adaptation for efficient energy capture.

What factors can affect the stability and function of recombinant CAB1 protein?

Several factors can significantly impact the stability and function of recombinant CAB1 protein:

  • Chlorophyll Association: As a chlorophyll-binding protein, CAB1 stability is often dependent on its association with chlorophyll molecules. Recombinant expression systems may need supplementation with chlorophyll or chlorophyll analogs to maintain proper protein folding.

  • Membrane Integration: CAB1 naturally functions within the thylakoid membrane. Recombinant versions may require appropriate detergents or lipid environments to maintain native conformation.

  • Storage Conditions: For antibodies against CAB1, proper storage is critical: lyophilized/reconstituted antibodies should be stored at -20°C with aliquoting recommended to avoid repeated freeze-thaw cycles . Similar care should be taken with recombinant proteins.

  • Light Exposure: As a light-harvesting protein, CAB1 may be sensitive to photooxidative damage. Storage and handling should minimize unnecessary light exposure.

  • Protein Concentration: Working at appropriate protein concentrations is essential, with typical western blot applications using 4-10 μg of total protein extract for reliable detection .

Researchers should carefully control these factors when working with recombinant CAB1 to ensure reproducible experimental results.

How can CAB1 be used to study photosystem assembly and dynamics?

CAB1 offers a valuable tool for investigating photosystem assembly and dynamics through several sophisticated approaches:

  • Fluorescence Resonance Energy Transfer (FRET): By tagging CAB1 and other photosystem components with fluorescent proteins, researchers can monitor protein-protein interactions and assembly dynamics in real-time.

  • Mutation Analysis: Generating specific mutations in the cab-1 gene allows for structure-function analysis of domain contributions to photosystem assembly.

  • Pulse-Chase Experiments: These can track the integration of newly synthesized CAB1 into existing photosystems, revealing assembly kinetics and turnover rates.

  • Co-immunoprecipitation Studies: Using antibodies like the polyclonal anti-Lhca1 (which reacts with Zea mays proteins) , researchers can isolate CAB1-containing complexes and identify interacting partners.

  • Comparative Analysis: The substantial sequence homology between maize cab-1 and CAB genes from other species provides an opportunity for evolutionary and comparative studies of photosystem assembly mechanisms .

These approaches collectively provide insights into how light-harvesting complexes assemble and function within the dynamic environment of the thylakoid membrane.

What approaches can be used to study the role of CAB1 in photoprotection mechanisms?

Studying CAB1's role in photoprotection involves several sophisticated methodological approaches:

  • High Light Stress Experiments: Expose plants to excess light conditions and analyze CAB1 abundance, modification state, and complex formation.

  • Reactive Oxygen Species (ROS) Measurement: Quantify ROS production in wild-type versus cab-1 mutant plants to assess the protein's contribution to ROS management.

  • Non-Photochemical Quenching (NPQ) Analysis: Measure NPQ parameters in plants with altered CAB1 levels to determine its role in excess energy dissipation.

  • Thylakoid Membrane Organization Studies: Use freeze-fracture electron microscopy or atomic force microscopy to visualize how CAB1 contributes to membrane reorganization during light stress.

  • Protein Phosphorylation Analysis: Investigate how phosphorylation of CAB1 changes under various light conditions, potentially using phospho-specific antibodies or mass spectrometry.

The findings from these approaches can be integrated to understand how CAB1 contributes to the plant's photoprotective mechanisms, which are essential for preventing photodamage under variable environmental conditions.

Why might Western blot detection of CAB1 show multiple bands or inconsistent results?

Multiple bands or inconsistent results in Western blot detection of CAB1 can occur for several research-specific reasons:

  • Post-translational Modifications: CAB1 may undergo various modifications (phosphorylation, glycosylation) resulting in multiple bands representing different modified forms.

  • Proteolytic Degradation: Insufficient protease inhibition during extraction can lead to partial protein degradation, generating multiple fragments.

  • Antibody Cross-Reactivity: The polyclonal anti-Lhca1 antibody may cross-react with other light-harvesting complex proteins due to sequence homology. For example, it reacts with proteins from various plant species including Arabidopsis thaliana, Hordeum vulgare, and Zea mays .

  • Sample Preparation Issues: Improper denaturation at 70°C for 5 minutes or inadequate blocking (recommended overnight at 4°C with 5% milk in TBS-T) can lead to inconsistent results .

  • Development Time Sensitivity: The BCIP-NBT-PLUS development system recommended for CAB1 detection is time-sensitive, with optimal results achieved after approximately 30 seconds of development followed by thorough washing protocols .

Troubleshooting FactorPotential Solution
Multiple bandsInclude phosphatase/glycosidase treatment controls
DegradationUse fresh protease inhibitor cocktail; keep samples cold
Cross-reactivityPre-adsorb antibody or use more specific monoclonal antibodies
Weak signalIncrease protein loading to 10 μg per well; extend primary antibody incubation
Background issuesExtend blocking time to overnight at 4°C as recommended

Addressing these factors systematically can lead to more consistent and interpretable Western blot results when working with CAB1.

How can researchers distinguish between different CAB protein isoforms in complex samples?

Distinguishing between different CAB protein isoforms requires a combination of sophisticated techniques:

  • 2D Gel Electrophoresis: Separating proteins by both isoelectric point and molecular weight can resolve closely related CAB isoforms that differ in post-translational modifications.

  • Isoform-Specific Antibodies: When available, antibodies that recognize unique epitopes in specific CAB isoforms provide direct identification. For example, the anti-Lhca1 antibody (AS01 005) is specific for PSI type I chlorophyll a/b-binding protein .

  • Mass Spectrometry Analysis: Liquid chromatography-mass spectrometry (LC-MS/MS) can identify unique peptide sequences that distinguish between highly similar CAB isoforms, even when they share substantial sequence homology.

  • Gene-Specific Probes: For mRNA analysis, highly specific probes can be designed to target unique regions. This approach has shown that cab-1 transcripts can represent up to 80% of total CAB mRNA in dark-grown seedlings .

  • Gradient Gel Systems: Using optimized gradient gels (such as 4-12% Bis-Tris) can improve resolution of closely related protein isoforms compared to fixed-percentage gels .

These techniques allow researchers to definitively identify specific CAB isoforms in complex plant extracts, enabling more precise functional studies of individual proteins within this important family.

What are the emerging research areas involving maize CAB1?

Several cutting-edge research areas involving maize CAB1 are emerging as promising fields for further investigation:

  • CRISPR/Cas9 Editing of cab-1: Precise genome editing enables the creation of novel cab-1 variants to study structure-function relationships with unprecedented specificity.

  • Climate Resilience: Understanding how CAB1 contributes to photosynthetic efficiency under climate stress conditions may help develop more resilient maize varieties.

  • Synthetic Biology Applications: Engineered CAB1 proteins might be incorporated into artificial photosynthetic systems for bioenergy production.

  • Systems Biology Integration: Combining transcriptomics, proteomics, and metabolomics data to understand CAB1's role in whole-plant photosynthetic networks.

  • Comparative Analysis Across Maize Landraces: Examining CAB1 sequence and expression variations across diverse maize varieties may reveal adaptations to different light environments.

These emerging areas represent the frontier of CAB1 research, offering opportunities to translate fundamental understanding into applications that address global challenges in agriculture and energy production.

How do findings about maize CAB1 translate to other crop species?

The translation of maize CAB1 research to other crop species provides valuable comparative insights:

  • Evolutionary Conservation: The extensive nucleotide homology within the protein coding region of maize cab-1 to CAB genes from other species suggests fundamental conservation of function .

  • Cross-Species Antibody Reactivity: Antibodies against Lhca1 show reactivity across diverse plant taxa, including both monocots and dicots such as Arabidopsis thaliana, Hordeum vulgare, Oryza sativa, and Triticum aestivum .

  • Regulatory Differences: While the gene structure shows conservation, the moderate light-upregulation of maize cab-1 (3- to 6-fold) may differ from other species, suggesting species-specific adaptations in photosynthetic regulation .

  • Methodological Transferability: Techniques developed for maize CAB1 research, such as the Western blot protocols using specific antibody dilutions (1:2000-1:5000), can be applied to other crop species with appropriate optimization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.