Recombinant Zea mays Chlorophyll a-b binding protein 48, chloroplastic (CAB48)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CAB48; Chlorophyll a-b binding protein 48, chloroplastic; LHCII type I CAB-48; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-264
Protein Length
Full Length of Mature Protein
Species
Zea mays (Maize)
Target Names
CAB48
Target Protein Sequence
RKTAAKPKPARSGSPWYGADRVLYLGPLSGSPPSYLTGEFPGDYGWDTEGLSADPETFAK NRELEVIHCRWAIAVGLGCVFPELLARNGVKFGEGVWFKAGSQIFSEGGLSHPGNPSLVH AQSILAIWACQVVLMGAVEGYHVAGGRLGEVVDPLYLGGSFDPLGLGDDPERFAELKVKE IKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLTDPVNNNAWAYATNFVPGK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Database Links

STRING: 4577.GRMZM2G429955_P01

UniGene: Zm.77645

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of CAB48 in maize photosynthesis?

Recombinant Zea mays Chlorophyll A-B Binding Protein 48, Chloroplastic (CAB48) is a key component of the light-harvesting complex in photosystem II of maize. It belongs to the family of chlorophyll a/b binding proteins that play crucial roles in light energy capture and transfer during photosynthesis.

Structurally, CAB48 contains multiple functional domains and modifiable sites that make it a target for physiological regulation of photosystem II in plant cells. The mature protein (amino acids 33-264) contains transmembrane domains that anchor it in the thylakoid membrane, with chlorophyll binding sites that coordinate chlorophyll a and b molecules.

Functionally, CAB48 contributes to:

  • Light harvesting for photosynthesis

  • Energy transfer to the reaction center in photosystem II

  • Balancing the distribution of excitation energy between photosystems I and II

  • Potential involvement in photoperiod response and circadian rhythms

Research has shown that chlorophyll a/b binding proteins like CAB48 are responsive to environmental stresses and may be involved in temperature adaptation mechanisms in maize .

What are the most effective expression systems for producing recombinant CAB48 protein?

The expression of recombinant CAB48 presents several challenges that researchers should consider when selecting a production system:

E. coli expression system challenges:

  • Bacterial expression of intact CAB48 is often problematic, with studies showing unexpected cleavage by bacterial peptidases following induced expression .

  • Immunoblot analysis has revealed nonspecific cleavage patterns that affect protein integrity .

Cell-free synthesis challenges:

  • Attempts to synthesize intact CAB48 using wheat germ extract have also proven difficult, consistent with the challenges encountered in bacterial expression systems .

Recommended approaches:

  • Plant-based expression systems: Tobacco leaf cell transfection using Agrobacterium harboring CAB48 gene expression constructs has shown higher success rates.

  • Chloroplast targeting strategies: When expressing in plant systems, using appropriate chloroplast-targeting peptides (cTPs) can significantly improve targeting efficiency and functional protein yields.

  • Controlled timing of expression: Peak transcript levels may not translate to maximum protein accumulation, so harvest timing should be optimized (often between 24-96 hours post-agroinfiltration for transient expression) .

For studies requiring large amounts of protein, a combination of optimized E. coli expression with extensive purification protocols may be necessary, but researchers should verify protein integrity through comprehensive immunoblot analysis.

How can researchers effectively measure CAB48 expression levels in different plant tissues?

Accurate quantification of CAB48 expression requires a multi-level approach examining both transcript and protein abundance:

Transcript level quantification:

  • qRT-PCR methodology: Use gene-specific primers targeting unique regions of CAB48 with Actin as an endogenous control. Calculate relative expression using the 2^-ΔΔCt method .

  • RNA-seq analysis: For transcriptome-wide analysis, collect approximately 50 million reads per sample, with alignment rates of >90% to the maize reference genome (RefGen_v4.42) considered acceptable .

Protein level quantification:

  • Western blot analysis: Use antibodies specific to CAB48 or conserved regions of chlorophyll a/b binding proteins.

  • iTRAQ-labeling method: For precise quantitative proteomics, this approach has successfully identified differential expression of CAB proteins in response to environmental factors .

  • CLSM imaging: Confocal laser scanning microscopy combined with fluorescence measurements can quantify the localization and abundance of CAB48-GFP fusion proteins in plant cells and within chloroplasts .

Tissue-specific considerations:

  • Expression levels vary significantly across tissues and developmental stages.

  • In leaf tissues, mean levels of chloroplast proteins should be measured throughout the growing season as levels often decline over time .

  • Protein extraction from chloroplast-rich tissues requires special buffers containing protease inhibitors to prevent degradation.

When comparing expression across conditions, researchers should collect samples at consistent times of day due to the potential circadian regulation of CAB proteins.

What experimental design considerations are important when studying CAB48 under different environmental stresses?

A robust experimental design for studying CAB48 under stress conditions should account for the following factors:

Environmental control parameters:

  • Maintain precise control of photoperiod, temperature, humidity, and light intensity.

  • Long photoperiod (LP) treatments should use 15h light/9h dark cycles for consistent results .

  • For temperature stress studies, use controlled gradients rather than single-point comparisons.

Sampling framework:

  • Implement a time-series experimental design with multiple sampling points (e.g., 6h, 24h) after treatment application .

  • Include both early response (6h) and adaptive response (24h+) timepoints.

  • Sample newly expanded leaves at defined developmental stages (e.g., three- and six-leaf stages) rather than by chronological age .

Control group design:

  • Utilize non-equivalent control group design where possible .

  • For genetic studies, include near-isogenic lines (NILs) that differ only in the gene/region of interest .

Statistical considerations:

  • Employ a minimum of three biological replicates per condition.

  • Use principal component analysis (PCA) to evaluate variability in gene expression between samples.

  • Apply appropriate statistical methods such as ANOVA with post-hoc tests for time-series data.

Example of experimental design elements from published research:

For studying temperature stress effects on CAB48:

  • Expose 5-day-old maize seedlings to control and treatment conditions

  • Collect samples at multiple timepoints (6h, 24h)

  • Generate approximately 50 million reads per sample through RNA-seq

  • Perform PCA analysis to explain variability in gene expression

  • Use agglomerative hierarchical clustering to confirm sample grouping based on treatment conditions

How should researchers interpret contradictory data regarding CAB48 expression under stress conditions?

Contradictory findings regarding CAB48 expression under stress conditions are not uncommon and require careful analysis. Here's a methodical approach to resolve such contradictions:

1. Examine experimental context differences:

  • Compare growth conditions, developmental stages, and specific maize genotypes used across studies.

  • Different maize varieties can show opposite regulation patterns of CAB genes under the same stress conditions.

2. Consider temporal dynamics:

  • CAB48 expression often follows complex temporal patterns under stress.

  • Some studies show immediate downregulation followed by recovery and upregulation.

  • Short-term vs. long-term responses may differ significantly.

3. Evaluate tissue-specificity:

  • Expression patterns may differ between mesophyll cells, bundle sheath cells, and other leaf tissues.

  • Whole-leaf homogenates can mask cell-type-specific responses.

4. Analyze interaction effects:

  • Multiple stresses applied simultaneously can result in different expression patterns than single stresses.

  • For example, from available research, we see that CAB genes can respond differently to combined stresses than to individual stressors .

5. Distinguish transcript vs. protein levels:

  • Transcriptional upregulation does not always translate to increased protein abundance.

  • Post-transcriptional and post-translational regulatory mechanisms may be at play.

When encountering contradictory data, researchers should discuss these in light of the specific CAB family member being studied, the temporal aspects of the stress response, and the possibility of functional redundancy or specialization among CAB proteins.

What statistical approaches should be used when analyzing differential expression of CAB48 across experimental conditions?

Robust statistical analysis of CAB48 differential expression requires appropriate methodologies at each step from data collection to interpretation:

Pre-processing and quality control:

  • Filter raw sequencing data (>50 million reads per library is recommended)

  • Assess alignment rates (>90% is considered optimal, with ~75% unique mapping)

  • Calculate FPKM (Fragments Per Kilobase Million) values for quantification

Normalization strategies:

  • Apply appropriate normalization methods to account for library size differences and composition bias

  • For RNA-seq data, TMM (Trimmed Mean of M-values) or DESeq2 normalization methods are recommended

  • For proteomics data (e.g., iTRAQ), use global mean or median normalization

Differential expression analysis:

  • Implement DESeq2 or edgeR packages for RNA-seq data

  • Set appropriate significance thresholds (typically q-value < 0.01)

  • Use log2 fold change thresholds (≥ 1 or ≤ -1 is commonly used)

  • Apply the apeglm method for LFC effect-size shrinkage to improve estimation

Multiple testing correction:

  • Always apply FDR (False Discovery Rate) correction for multiple comparisons

  • Benjamini-Hochberg procedure is commonly used in expression studies

Visualization and interpretation:

  • Use PCA to visualize sample clustering and explain variability (>70% variability explained by first three principal components is ideal)

  • Apply agglomerative hierarchical clustering to confirm sample grouping

  • Generate volcano plots to visualize both statistical significance and fold change

Example statistical workflow:
From a study examining maize response to photoperiod, researchers:

  • Generated 817.8 million raw reads (~51.11 million per library)

  • Processed to 803.2 million high-quality reads (~50.2 million per library)

  • Achieved 93.57% average alignment rate with 78.5% unique mapping

  • Used PCA to explain >70% of variability with first three principal components

  • Applied hierarchical clustering to confirm sample grouping by treatment conditions

  • Identified differentially expressed genes using q-value < 0.01 and log2FC thresholds of ≥1 or ≤-1

When analyzing CAB48 specifically, researchers should consider its expression in context with other photosynthetic genes to identify coordinated regulation patterns.

How can CAB48 be used as a marker for photosynthetic efficiency in maize breeding programs?

CAB48 can serve as a valuable molecular marker for photosynthetic efficiency in maize breeding programs through several methodological approaches:

Marker development strategy:

  • Haplotype analysis: Different haplotypes of CAB48 have been associated with varying chlorophyll content (CC). Research has shown that specific haplotypes correlate with higher photosynthetic efficiency .

  • QTL mapping: Incorporate CAB48 polymorphisms into QTL analyses to identify associations with photosynthetic traits. For example, studies have identified significant QTNs in chlorophyll-related genes that differentiate between photosynthetic efficiency phenotypes .

  • Expression-based markers: Develop markers based on expression levels of CAB48 under standardized conditions, as expression levels correlate with photosynthetic capacity.

Implementation methodology:

  • Phenotypic correlation studies: Establish baseline correlations between CAB48 variants/expression and photosynthetic parameters like:

    • Chlorophyll content

    • CO₂ assimilation rates

    • Quantum efficiency of PSII

    • Crop yield under various environmental conditions

  • High-throughput screening: Develop PCR-based markers targeting CAB48 polymorphisms for rapid screening of breeding populations.

  • Controlled environment testing: Evaluate photosynthetic efficiency under standardized conditions to minimize environmental variability.

Validation approaches:

  • Near-isogenic line (NIL) comparisons: Compare NILs differing only in CAB48 alleles to confirm photosynthetic phenotypic differences.

  • Multi-environment trials: Test the predictive value of CAB48 markers across diverse environments to ensure broad applicability.

  • Integration with other markers: Combine CAB48 markers with other photosynthesis-related gene markers for improved predictive power.

Practical application example:
In one study examining chlorophyll content in maize, researchers identified that the functional characterization of ZmCCS3 indicated the encoded protein likely contributes to chlorophyll biosynthesis. The chlorophyll content differed significantly between haplotypes of the significant QTN in this gene, with higher chlorophyll content observed in haplotype 1 . Similar approaches could be applied to CAB48 to develop markers for breeding programs focused on photosynthetic efficiency.

What are the most effective methods for studying CAB48 protein-protein interactions within the photosynthetic apparatus?

Investigating CAB48 protein-protein interactions within the photosynthetic machinery requires specialized techniques that preserve the native membrane environment and complex formation. Here are the most effective methodological approaches:

In vivo interaction analysis:

  • Split-GFP/BiFC (Bimolecular Fluorescence Complementation):

    • Fuse split fragments of fluorescent proteins to CAB48 and potential interacting partners

    • Express in plant systems using chloroplast-targeting peptides

    • Visualize using conformal laser scanning microscopy (CLSM)

    • Quantify fluorescence both in plant cells and within chloroplasts

  • FRET (Förster Resonance Energy Transfer):

    • Label CAB48 and potential partners with appropriate fluorophore pairs

    • Measure energy transfer efficiency as indicator of proximity

    • Particularly useful for dynamic interactions during state transitions

In vitro approaches:

  • Co-immunoprecipitation with membrane solubilization:

    • Solubilize thylakoid membranes using mild detergents (β-DDM or digitonin)

    • Immunoprecipitate using antibodies against CAB48

    • Identify co-precipitated proteins using mass spectrometry

  • Blue native PAGE:

    • Separate intact protein complexes under native conditions

    • Western blot with anti-CAB48 antibodies to identify complex incorporation

    • Excise bands for second-dimension separation and protein identification

Crosslinking mass spectrometry (XL-MS):

  • Apply membrane-permeable crosslinkers to stabilize transient interactions

  • Digest crosslinked complexes and analyze by LC-MS/MS

  • Identify interaction interfaces through computational analysis of crosslinked peptides

Challenges and solutions:

  • Challenge: Maintaining native membrane environment
    Solution: Use isolated intact chloroplasts for in organello studies rather than recombinant proteins

  • Challenge: Distinguishing direct from indirect interactions
    Solution: Combine multiple complementary techniques and validate with targeted mutagenesis

  • Challenge: Low abundance of some interaction partners
    Solution: Employ sensitive detection methods like selective reaction monitoring (SRM) MS

Experimental workflow example:
One effective approach demonstrated in research combined:

  • Isolation of intact chloroplasts from plant tissue

  • In vitro import assay with recombinant CAB proteins

  • Time-course analysis (5, 15, and 25 minutes)

  • Recovery of proteins from import reactions

  • Immunoblotting to assess complex formation

This multi-technique approach provides complementary data on both stable and transient interactions of CAB48 within the photosynthetic apparatus.

What are the main challenges in purifying recombinant CAB48 protein and how can they be overcome?

Purification of recombinant CAB48 protein presents several significant challenges due to its hydrophobic nature and chloroplast targeting. Here are the major challenges and methodological solutions:

Challenge 1: Expression system limitations

Problem: Bacterial expression systems often fail to yield purified recombinant CAB48. Evidence shows unexpected cleavage of recombinant CAB48 by bacterial peptidases following induced expression in E. coli cells .

Solutions:

  • Test multiple expression strains optimized for membrane proteins (e.g., C41(DE3), C43(DE3))

  • Lower induction temperature (16-18°C) and IPTG concentration

  • Use fusion partners like MBP or SUMO that can enhance solubility

  • Consider cell-free expression systems with supplemented lipids/detergents

Challenge 2: Protein instability and degradation

Problem: Nonspecific cleavage of intact CAB48 by both bacterial and plant peptidases indicates instability issues .

Solutions:

  • Add protease inhibitor cocktails throughout purification

  • Include reducing agents to prevent oxidative damage

  • Optimize buffer compositions with stabilizing agents like glycerol

  • Perform all steps at 4°C to minimize degradation

  • Consider purifying protein complexes rather than individual proteins

Challenge 3: Membrane protein solubilization

Problem: As a membrane protein, CAB48 requires detergents for solubilization, which can affect protein folding and function.

Solutions:

  • Screen multiple detergents (DDM, LDAO, Fos-choline) at different concentrations

  • Use fluorescence-based thermal shift assays to identify optimal detergent conditions

  • Consider amphipol or nanodisc technologies for detergent-free purification

  • Develop stepwise detergent exchange protocols during purification

Challenge 4: Maintaining chlorophyll association

Problem: Functional CAB48 requires bound chlorophyll molecules, which are often lost during recombinant expression and purification.

Solutions:

  • Supplement growth media with chlorophyll precursors for bacterial systems

  • Reconstitute purified protein with purified pigments

  • Consider plant-based expression systems that naturally contain chlorophyll biosynthetic machinery

Successful purification strategy example:
Based on published research approaches, a recommended workflow would be:

  • Express CAB48 in a plant-based system (e.g., tobacco leaves via Agrobacterium-mediated transformation)

  • Sample at optimal time points post-agroinfiltration (48-72h based on fluorometric measurements)

  • Isolate intact chloroplasts using Percoll gradient centrifugation

  • Solubilize thylakoid membranes with 1% β-DDM

  • Purify using immobilized metal affinity chromatography with His-tagged constructs

  • Verify protein integrity through immunoblot analysis with appropriate antibodies

  • Assess functionality through chlorophyll binding and spectroscopic analyses

This combined approach addresses multiple challenges simultaneously and has shown greater success than bacterial expression alone.

How can researchers differentiate between the functions of CAB48 and other closely related chlorophyll a/b binding proteins?

Differentiating the specific functions of CAB48 from other closely related chlorophyll a/b binding proteins requires sophisticated methodological approaches that isolate its unique contributions. Here are effective strategies:

Genetic approaches:

  • Specific gene silencing:

    • Develop artificial microRNA (amiRNA) constructs specifically targeting CAB48 while preserving other CAB genes

    • Create knockdown lines with varying levels of suppression to identify dose-dependent effects

    • Compare phenotypes with wild-type plants under various conditions

  • Complementation studies:

    • In CAB48 knockdown/knockout lines, introduce CAB48 or other CAB family members under controlled expression

    • Assess which functions are restored by CAB48 only versus those that can be complemented by other family members

Biochemical differentiation:

  • Protein-specific antibody development:

    • Generate antibodies against unique epitopes of CAB48

    • Validate specificity against other CAB proteins

    • Use for immunoprecipitation and immunolocalization studies

  • Comparative proteomics:

    • Isolate protein complexes containing CAB proteins from wild-type and mutant plants

    • Apply differential quantitative proteomics to identify specific CAB48-dependent interactions

    • Use isotope labeling techniques (SILAC, iTRAQ) for precise quantification

Functional characterization:

  • Stress-specific responses:

    • Examine CAB48 expression patterns under multiple stress conditions compared to other CAB proteins

    • Research has shown that different CAB family members respond distinctly to stresses

    • For example, in tea plants, CsCP1 expression was inhibited by 6 stresses, while CsCP2 was upregulated only after cold stress and ABA treatment

  • Photosynthetic parameter analysis:

    • Compare quantum yield, electron transport rates, and non-photochemical quenching in wild-type versus CAB48-altered plants

    • Measure state transition kinetics to identify specific roles in energy distribution

Structural and interaction studies:

  • Domain swap experiments:

    • Create chimeric proteins between CAB48 and other CAB proteins

    • Test which domains confer CAB48-specific functions

  • Comparative modeling:

    • Perform computational structural analysis to identify unique features of CAB48

    • Model pigment binding sites and protein interaction surfaces

Example experimental approach from literature:
In a study examining the closely related Lhcb1 and Lhcb2 proteins, researchers found that:

  • amiLhcb1 plants grew more slowly than wild type with smaller, paler leaves

  • Chlorophyll content was reduced by ~30% compared to wild type

  • The chlorophyll a/b ratio increased to 4.0 from 3.2 in wild type

  • Under fluctuating light conditions, both amiLhcb1 and amiLhcb2 showed stunted growth

Such comparative approaches could be applied to differentiate CAB48's specific functions from other family members, examining growth, pigmentation, and photosynthetic efficiency under various conditions.

How can Community Advisory Boards (CABs) enhance research projects focused on photosynthetic proteins like CAB48?

Community Advisory Boards (CABs) can significantly strengthen research on photosynthetic proteins like CAB48 by providing diverse perspectives and improving research relevance. Here's a methodological approach to implementing CABs in this research context:

CAB composition and structure for CAB48 research:

  • Diverse membership selection:

    • Include agricultural scientists, plant breeders, and farmers who work with maize

    • Incorporate experts from related fields (biophysics, structural biology, bioinformatics)

    • Recruit representatives from seed companies and agricultural extension services

    • Consider including policy makers interested in crop improvement

  • Operational framework:

    • Establish clear roles, goals, and responsibilities through formal member agreements

    • Develop a structured meeting schedule (quarterly is often effective)

    • Create communication channels between meetings to maintain engagement

    • Compensate members appropriately for their expertise and time

Specific CAB contributions to CAB48 research:

  • Research question development:

    • CAB members can identify practical applications that may not be obvious to bench scientists

    • Help prioritize research questions based on agricultural needs and challenges

    • For example, CAB members might suggest investigating how CAB48 variants perform under specific regional growing conditions

  • Study design refinement:

    • Provide input on experimental conditions relevant to real-world agricultural settings

    • Suggest additional variables to consider based on field experience

    • Help design studies that bridge laboratory findings with field applications

  • Implementation improvements:

    • Assist with field trial design and recruitment of cooperative farms

    • Suggest culturally appropriate communication approaches for recruiting diverse study participants

    • Help identify potential partners for collaborative research

  • Data interpretation and dissemination:

    • Provide context for understanding unexpected results

    • Suggest practical implications of findings for different stakeholder groups

    • Recommend effective channels for disseminating results to various audiences

Evidence of CAB impact from research:
A study assessing researchers' experiences with CABs found that they influenced research in multiple domains:

  • Pre-research conceptualization (24%)

  • Infrastructure development (24%)

  • Study design (41%)

  • Implementation (41%)

  • Analysis (6%)

  • Dissemination (24%)

  • Post-research activities (18%)

Implementation methodology:

  • Develop clear CAB charter and governance documents

  • Create a one-page study overview for potential CAB members

  • Establish evaluation metrics for CAB impact

  • Document CAB feedback systematically using structured templates

  • Maintain engagement through regular updates between meetings

By integrating a CAB into CAB48 research, scientists can enhance real-world relevance while maintaining scientific rigor, ultimately accelerating translation of findings into agricultural applications.

What are the most important methodological considerations when designing experiments to test CAB48 transgenic plants under field conditions?

Designing field experiments for CAB48 transgenic plants requires careful methodological considerations to ensure valid, reliable results while addressing regulatory and environmental concerns:

Experimental design fundamentals:

  • Statistical power and replication:

    • Implement randomized complete block designs with adequate replication

    • Account for spatial variability in field conditions

    • Calculate appropriate sample sizes using power analysis

    • Consider the non-equivalent control group design when perfect randomization is not possible

  • Control selection:

    • Include near-isogenic lines differing only in the CAB48 transgene

    • Use null segregants as additional controls

    • Include conventional varieties as agricultural benchmarks

    • Implement border rows to minimize edge effects

  • Environmental variation management:

    • Select multiple testing locations representing different growing conditions

    • Consider multi-year trials to account for seasonal variation

    • Implement the recurrent institutional cycle design for long-term studies

    • Monitor and record detailed environmental data throughout the growing season

Regulatory compliance methodology:

  • Containment and biosafety:

    • Design isolation distances based on maize pollen flow data

    • Implement pollen barriers using non-transgenic border rows

    • Schedule planting to avoid cross-pollination with nearby conventional maize

    • Develop protocols for material disposal and site monitoring post-harvest

  • Documentation requirements:

    • Maintain detailed records of the transgenic construct design

    • Document protein expression levels across tissues and developmental stages

    • Example: In MON 89034, mean Cry2Ab2 protein levels (μg/g dwt) varied from 130-180 in leaf, 21-58 in root, and 38-130 in whole plant

    • Monitor protein expression levels throughout the growing season

Phenotypic evaluation methodology:

  • Photosynthetic parameters:

    • Measure chlorophyll content using both destructive and non-destructive methods

    • Quantify photosynthetic efficiency through gas exchange and chlorophyll fluorescence

    • Implement diurnal measurements to capture temporal variation

    • Compare responses under fluctuating light conditions, which have revealed performance differences in other CAB protein mutants

  • Stress response protocols:

    • Evaluate performance under controlled stress conditions (drought, temperature, light)

    • Monitor gene expression changes in response to environmental stressors

    • Implement the time-series experimental design for tracking stress responses over time

    • Compare CAB48 transgenic lines with controls across multiple stress intensities

Data collection standardization:

  • Growth and development metrics:

    • Record key developmental stages (emergence, vegetative stages, flowering, maturity)

    • Measure growth parameters systematically (height, leaf area, biomass)

    • Document phenological differences between transgenic and control plants

    • Track source-sink relationships throughout development

  • Yield component analysis:

    • Assess individual yield components (kernel number, kernel weight, ears per plant)

    • Evaluate grain quality parameters relevant to end use

    • Measure harvest index to assess biomass partitioning

    • Compare yield stability across environments

Example field trial parameters from literature:
When evaluating photosynthesis-related traits in maize, researchers have implemented:

  • Multiple testing locations to capture genotype × environment interactions

  • Detailed environmental monitoring including temperature, precipitation, and light intensity

  • Growth parameter measurements at multiple developmental stages

  • Yield evaluations to connect physiological improvements to agricultural performance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.