Recombinant Zea mays Chlorophyll a-b binding protein M9, chloroplastic (CAB-M9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CAB-M9; Chlorophyll a-b binding protein M9, chloroplastic; LHCII type I CAB-M9; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-265
Protein Length
Full Length of Mature Protein
Species
Zea mays (Maize)
Target Names
CAB-M9
Target Protein Sequence
RKTAAKAKPAASSGSPWYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFA KNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLI HAQSILAIWACQVVLMGAIEGYRVAGGPLGEVVDPLYPGGTFDPLGLADDPEAFADVKVK ELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Database Links

KEGG: zma:542530

STRING: 4577.GRMZM2G155216_P02

UniGene: Zm.93642

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of Chlorophyll a-b binding protein M9 in Zea mays?

Chlorophyll a-b binding protein M9 (CAB-M9) is a light-harvesting complex protein primarily involved in photosynthesis in maize (Zea mays). This protein functions by:

  • Binding chlorophyll a and b molecules to optimize light absorption across different wavelengths

  • Transferring captured light energy to photosystem reaction centers

  • Contributing to photoprotection mechanisms during high light conditions

  • Participating in thylakoid membrane organization and stability

The CAB-M9 protein specifically localizes to the chloroplast, where it integrates into the thylakoid membrane system. Unlike some other CAB proteins, CAB-M9 shows distinctive expression patterns during diurnal cycles and developmental stages, suggesting specialized roles in maize photosynthetic adaptation.

How does recombinant CAB-M9 differ from native CAB-M9 protein?

Recombinant CAB-M9 and native CAB-M9 differ in several key aspects:

ParameterNative CAB-M9Recombinant CAB-M9
SourceExtracted directly from Zea maysExpressed in heterologous systems (E. coli, yeast, insect cells)
PurityContains plant-derived contaminantsHigher purity possible through affinity purification
Post-translational modificationsContains all natural modificationsMay lack certain modifications depending on expression system
Structural authenticityComplete native conformationMay have minor structural differences
Chlorophyll bindingPre-loaded with chlorophyllOften purified as apoprotein (without chlorophyll)
Experimental controlVariable between extractionsHigher batch-to-batch consistency
Scale availabilityLimited by plant materialCan be produced at larger scales

When designing experiments, researchers must account for these differences, particularly when studying structure-function relationships or conducting in vitro reconstitution studies. Verification of proper folding and function in recombinant versions is essential through techniques such as circular dichroism spectroscopy and chlorophyll binding assays.

What expression systems are most suitable for producing recombinant CAB-M9?

The choice of expression system for recombinant CAB-M9 production depends on experimental requirements:

E. coli expression systems:

  • Advantages: High yield, rapid growth, cost-effective, well-established protocols

  • Limitations: Lacks chloroplast-specific chaperones, tendency to form inclusion bodies, no post-translational modifications

  • Optimization: Use of specialized strains (Rosetta, Origami), lower induction temperatures (16-20°C), fusion tags (MBP, SUMO)

Yeast expression systems:

  • Advantages: Eukaryotic folding machinery, higher success with membrane proteins, moderate cost

  • Limitations: Lower yield than E. coli, longer production time

  • Recommended strains: Pichia pastoris for secreted expression, Saccharomyces cerevisiae for membrane proteins

Insect cell expression systems:

  • Advantages: Advanced eukaryotic folding, suitable for complex proteins, better post-translational modifications

  • Limitations: Higher cost, technical complexity, longer production timeline

  • Recommended for: Structural studies requiring native-like protein conformation

Plant-based expression systems:

  • Advantages: Native-like processing, natural chloroplast targeting, appropriate post-translational modifications

  • Limitations: Lower yield, longer production time, complex purification

  • Particularly valuable for: Functional studies requiring authentic protein-pigment interactions

The optimal procedure involves testing multiple expression systems in parallel using standardized experimental design principles to determine which system provides the best balance of yield, purity, and biological activity for specific research applications.

What are the critical controls needed when studying recombinant CAB-M9 function in vitro?

Rigorous experimental design for in vitro studies of recombinant CAB-M9 requires multiple controls:

Essential negative controls:

  • Empty vector control - Expression and purification from host cells containing empty expression vector

  • Denatured protein control - Heat-denatured CAB-M9 to confirm activity is structure-dependent

  • Substrate-free control - Reaction mixtures without chlorophyll or other binding partners

  • Buffer-only control - Complete reaction buffer without added protein

Essential positive controls:

  • Native protein control - When available, native CAB-M9 extracted from Zea mays

  • Characterized homolog - Well-studied chlorophyll binding protein from related species

  • Activity standard - Commercially available light-harvesting complex with established activity

Additional experimental controls:

  • Site-directed mutants targeting key binding residues

  • Time-course measurements to establish reaction kinetics

  • Concentration gradients to determine dose-dependent effects

  • Multiple preparation batches to confirm reproducibility

A properly designed experiment must include at least three biological replicates and three technical replicates for each condition, with appropriate statistical analysis to determine significance. When establishing new methods, validation against existing literature values for related proteins is essential for confirming experimental reliability.

How can I design experiments to study CAB-M9's interaction with photosystem complexes?

Studying CAB-M9's interaction with photosystem complexes requires a multi-technique approach:

Co-immunoprecipitation (Co-IP) studies:

  • Generate antibodies specific to CAB-M9 or use epitope-tagged recombinant versions

  • Solubilize thylakoid membranes with mild detergents (n-dodecyl-β-D-maltoside at 1%)

  • Perform pull-down assays followed by identification of interacting partners

  • Include cross-linking steps to capture transient interactions

Fluorescence resonance energy transfer (FRET):

  • Label CAB-M9 and potential binding partners with appropriate fluorophore pairs

  • Measure energy transfer as indicator of proximity and interaction

  • Use both steady-state and time-resolved measurements for comprehensive analysis

  • Include competition assays with unlabeled proteins to confirm specificity

Surface plasmon resonance (SPR):

  • Immobilize purified photosystem complexes on sensor chips

  • Measure binding kinetics of recombinant CAB-M9 at various concentrations

  • Determine association/dissociation rate constants and binding affinities

  • Test environmental factors (pH, ionic strength) affecting interaction stability

Native gel electrophoresis and size exclusion chromatography:

  • Analyze complex formation under non-denaturing conditions

  • Compare migration patterns of individual proteins versus reconstituted complexes

  • Isolate complexes for further functional characterization

  • Combine with western blotting to confirm component identities

The experimental design should include systematic variation of conditions including pH (5.5-8.0), salt concentration (50-300 mM), temperature (4-30°C), and lipid composition to identify physiologically relevant interaction parameters.

What are the most effective methods for measuring chlorophyll binding properties of recombinant CAB-M9?

Measuring chlorophyll binding properties of recombinant CAB-M9 requires specialized techniques:

Spectroscopic methods:

  • Absorption spectroscopy:

    • Record spectra (350-750 nm) before and after protein addition to chlorophyll solutions

    • Calculate binding parameters from difference spectra

    • Monitor for characteristic shifts in absorption maxima (≈1-3 nm red shift upon binding)

  • Fluorescence spectroscopy:

    • Measure chlorophyll fluorescence quenching upon protein binding

    • Determine binding constants through titration experiments

    • Use fluorescence anisotropy to assess rotational constraints upon binding

  • Circular dichroism:

    • Record spectra in far-UV (secondary structure) and visible range (pigment environment)

    • Monitor structural changes associated with chlorophyll binding

    • Compare spectra with native complexes isolated from maize

Binding assays:

  • Equilibrium dialysis:

    • Separate protein and free chlorophyll compartments with semi-permeable membrane

    • Allow equilibration and measure distribution at various concentrations

    • Calculate binding parameters using Scatchard analysis

  • Isothermal titration calorimetry:

    • Measure heat changes during chlorophyll-protein interaction

    • Determine thermodynamic parameters (ΔH, ΔS, Kd)

    • Distinguish between binding sites with different affinities

  • Native mass spectrometry:

    • Analyze intact protein-pigment complexes under non-denaturing conditions

    • Determine stoichiometry of chlorophyll binding

    • Characterize complex stability through varying conditions

The table below summarizes typical chlorophyll binding parameters for CAB family proteins:

ParameterChlorophyll aChlorophyll bMethod
Binding sites per monomer3-52-3Native MS/ITC
Kd (nM)10-5020-100Fluorescence titration
ΔH (kJ/mol)-35 to -45-30 to -40ITC
Stoichiometry (Chl:protein)3:1 to 5:12:1 to 3:1Native MS

When conducting these assays, careful control of environmental conditions is essential, as temperature, light exposure, and oxygen can significantly affect chlorophyll stability and binding measurements.

How does post-translational modification affect CAB-M9 function and stability?

Post-translational modifications (PTMs) significantly impact CAB-M9 function and stability through multiple mechanisms:

Phosphorylation:

  • Primary sites: N-terminal threonine residues and stromal-exposed loops

  • Functional consequences: Regulates association with photosystem complexes, particularly during state transitions

  • Regulatory enzymes: STN7 kinase (activation in low light) and TAP38/PPH1 phosphatase (deactivation in high light)

  • Experimental approach: Use phosphomimetic mutations (S/T to D/E) or phospho-null mutations (S/T to A) to assess functional impacts

N-terminal processing:

  • Transit peptide removal: Essential for proper chloroplast localization

  • N-terminal methionine excision: Affects protein stability and half-life

  • Analytical methods: Mass spectrometry comparison of recombinant versus native protein to identify processing sites

Acetylation:

  • Common sites: Lysine residues in membrane-proximal regions

  • Functional impact: Modulates protein-protein interactions and assembly into larger complexes

  • Detection methods: Antibodies against acetyl-lysine followed by western blotting or targeted MS/MS analysis

The comprehensive analysis of PTMs requires an integrated workflow:

  • Isolate native CAB-M9 from maize chloroplasts under various light conditions

  • Perform proteomic analysis using high-resolution mass spectrometry

  • Map identified modifications to protein structural model

  • Generate recombinant variants mimicking or lacking specific modifications

  • Compare functional parameters between variants

Recent research has shown that phosphorylation patterns vary significantly depending on:

  • Diurnal cycle (higher phosphorylation during dawn/dusk transitions)

  • Light intensity (increased phosphorylation under low light)

  • Plant developmental stage (differential regulation during leaf maturation)

Researchers should carefully consider experimental conditions when studying PTMs, as extraction methods and sample handling can significantly alter modification states.

What approaches can resolve conflicting data on CAB-M9 oligomerization state?

Conflicts in CAB-M9 oligomerization data often arise from differences in experimental conditions. A systematic approach to resolve these conflicts includes:

Multi-technique verification:

  • Analytical ultracentrifugation:

    • Measure sedimentation velocity and equilibrium parameters

    • Calculate molecular weight independent of molecular shape

    • Distinguish between multiple oligomeric species in equilibrium

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS):

    • Determine absolute molecular mass independent of shape

    • Analyze concentration-dependent oligomerization

    • Detect heterogeneity in oligomeric states

  • Native mass spectrometry:

    • Directly measure masses of intact complexes

    • Determine stoichiometry of protein and bound pigments

    • Assess stability of various oligomeric forms

  • Cross-linking mass spectrometry:

    • Identify specific residues at protein-protein interfaces

    • Distinguish specific from non-specific interactions

    • Generate restraints for structural modeling

Systematic variation of conditions:
Examine oligomerization across a matrix of conditions:

ParameterRange to testExpected impact
pH5.5-8.0Affects electrostatic interactions
Ionic strength50-500 mMScreens charge interactions
Detergent typeDDM, OG, LDAOMimics different membrane environments
Detergent concentration0.5-5× CMCModulates protein-detergent interactions
Lipid compositionMGDG, DGDG, SQDGStabilizes native oligomeric states
Protein concentration0.1-10 mg/mLReveals concentration-dependent assembly
Temperature4-30°CShows thermodynamic preferences

Reconciliation strategies:

  • Create phase diagrams mapping oligomeric states across different conditions

  • Correlate oligomeric state with functional activity

  • Compare with conditions in native thylakoid membrane

  • Use mutagenesis to identify interface residues critical for oligomerization

When reporting results, researchers should explicitly detail all experimental conditions and sample preparation methods to allow proper comparison between studies and avoid perpetuating conflicting data in the literature.

How can I distinguish between specific and non-specific effects when studying CAB-M9 interactions with lipids?

Distinguishing between specific and non-specific lipid interactions with CAB-M9 requires systematic methodology:

Experimental approaches:

  • Lipid overlay assays:

    • Screen multiple lipid types immobilized on membranes

    • Include both native chloroplast lipids and non-native controls

    • Quantify binding strength across lipid gradients

  • Microscale thermophoresis:

    • Measure binding affinities in solution

    • Compare native lipids versus structurally related analogs

    • Determine thermodynamic parameters for binding

  • Native nanodiscs:

    • Reconstitute CAB-M9 in defined lipid environments

    • Systematically vary lipid composition

    • Assess functional parameters in different lipid contexts

  • Hydrogen-deuterium exchange mass spectrometry:

    • Identify specific protein regions involved in lipid interactions

    • Compare exchange rates in different lipid environments

    • Map interaction sites on protein structural models

Criteria for specific interactions:

  • Saturable binding with defined stoichiometry

  • High selectivity for particular lipid species

  • Competition by structurally related but not unrelated lipids

  • Conserved binding sites across homologous proteins

  • Functional consequences when specific interactions are disrupted

Control experiments for validation:

  • Site-directed mutagenesis of putative lipid-binding sites

  • Competition assays between labeled and unlabeled lipids

  • Comparison with known lipid-binding proteins (positive control)

  • Testing with scrambled/inverted lipids (negative control)

The table below outlines a systematic approach to testing lipid specificity:

Lipid classNative chloroplastNon-native controlExpected specific binding
MGDG16:0/18:3 MGDG16:0/16:0 MGDGYes, acyl chain specificity
DGDG18:3/18:3 DGDGLactosyl ceramideYes, head group specificity
SQDG16:0/18:3 SQDGSulfatidePartial, sulfate recognition
PG16:0/18:1 PG16:0/18:1 PCYes, head group specificity
Non-chloroplastCholesterol-No, negative control

For the most convincing evidence, functional assays should demonstrate that specific lipid interactions influence measurable parameters such as thermal stability, chlorophyll binding capacity, or energy transfer efficiency.

What statistical approaches are most appropriate for analyzing CAB-M9 spectroscopic data?

Analyzing CAB-M9 spectroscopic data requires specialized statistical approaches for different experimental contexts:

Absorption spectroscopy analysis:

  • Baseline correction and normalization:

    • Subtract baseline measured from buffer-only samples

    • Normalize to protein concentration for cross-sample comparison

    • Apply Savitzky-Golay smoothing to reduce noise while preserving spectral features

  • Spectral deconvolution:

    • Use Gaussian component analysis to resolve overlapping peaks

    • Apply constraint-based fitting for known chlorophyll a and b spectral signatures

    • Validate component assignments through standards and controls

  • Statistical validation:

    • Calculate residuals to assess goodness of fit

    • Perform F-test comparison between simplified and complex models

    • Report 95% confidence intervals for peak positions and amplitudes

Time-resolved fluorescence data:

  • Multi-exponential decay analysis:

    • Apply maximum likelihood estimation for decay component fitting

    • Use information theory criteria (AIC/BIC) to determine optimal number of components

    • Perform global analysis across multiple emission wavelengths

  • Kinetic model discrimination:

    • Formulate alternative kinetic schemes with different energy transfer pathways

    • Compare fit quality using χ² statistics and residual analysis

    • Apply parameter identifiability analysis to assess model robustness

Circular dichroism spectra:

  • Secondary structure estimation:

    • Compare against reference datasets (SELCON, CDSSTR, K2D)

    • Apply singular value decomposition to identify principal components

    • Validate through comparison with homologous proteins of known structure

  • Thermal denaturation analysis:

    • Fit to two-state or multi-state unfolding models

    • Calculate thermodynamic parameters (Tm, ΔH, ΔCp)

    • Apply statistical F-test to determine appropriate model complexity

The table below summarizes recommended statistical approaches for different data types:

Data typeRecommended statistical approachSoftware tools
Steady-state absorptionGaussian peak fitting, ANOVA for comparisonOriginPro, R (package: peaks)
Time-resolved fluorescenceMaximum likelihood estimation, global analysisDAS6, Globals, TIMP package
Circular dichroismSVD-based analysis, bootstrap samplingCDPro suite, DichroWeb
Binding isothermsNon-linear regression, Scatchard analysisGraphPad Prism, R
Thermal stabilityBoltzmann fitting, van't Hoff analysisOriginPro, CDpal

For experimental design, power analysis should be performed to determine the minimum number of replicates needed (typically 3-5 independent preparations) to detect physiologically relevant effects with 80% power at α=0.05.

How can I reconcile contradictory findings on CAB-M9 expression patterns under different environmental conditions?

Contradictory findings regarding CAB-M9 expression patterns often stem from methodological differences or environmental complexities. Resolution requires systematic analysis:

Sources of experimental variation:

Reconciliation approaches:

  • Meta-analysis framework:

    • Standardize expression data across studies (z-score normalization)

    • Weight studies by methodological rigor and sample size

    • Identify consistent patterns across diverse conditions

  • Multi-factorial experimental design:

    • Systematically vary environmental parameters

    • Use full factorial design to identify interaction effects

    • Apply principal component analysis to identify major drivers of variation

  • Time-course resolution:

    • Implement high-temporal-resolution sampling

    • Analyze expression rhythms using Fourier transformation

    • Identify phase shifts rather than simple up/down regulation

Statistical framework for meta-analysis:

FactorAnalysis methodExpected outcome
Light intensityRegression analysisIdentify threshold effects and saturation points
Diurnal patternsCosine curve fittingDetermine phase, amplitude, and period length
Developmental stageANCOVA with age as covariateSeparate age effects from treatment effects
Stress responsesTime-series clusteringGroup conditions by temporal expression patterns

When designing experiments to resolve contradictions:

  • Include positive and negative controls from previous studies

  • Measure multiple CAB family members simultaneously for context

  • Corroborate RNA data with protein levels and functional assays

  • Explicitly report all environmental parameters and measurement methods

This systematic approach allows researchers to identify context-dependent regulation and build a more comprehensive understanding of CAB-M9 expression across environmental conditions.

What methods can differentiate between direct and indirect effects in CAB-M9 gene knockout/knockdown studies?

Differentiating between direct and indirect effects in CAB-M9 knockout/knockdown studies requires a multi-layered experimental approach:

Temporal analysis:

  • High-resolution time-course studies:

    • Sample at multiple time points post-knockdown (1h, 6h, 24h, 72h)

    • Distinguish immediate (likely direct) from delayed (likely indirect) responses

    • Apply time-series clustering to identify co-regulated gene groups

  • Inducible knockout systems:

    • Use conditional promoters or CRISPR interference systems

    • Monitor initial perturbations versus adaptive responses

    • Establish timeline for primary versus secondary effects

Network analysis approaches:

  • Transcriptome profiling:

    • Compare global expression patterns between wildtype and knockout

    • Apply differential expression analysis with strict FDR correction (q<0.05)

    • Use WGCNA (Weighted Gene Co-expression Network Analysis) to identify modules affected by CAB-M9 perturbation

  • Proteome analysis:

    • Quantify protein abundance changes using iTRAQ or TMT labeling

    • Assess post-translational modification alterations

    • Correlate protein-level changes with transcript alterations

  • Metabolomic profiling:

    • Monitor changes in photosynthetic intermediates and products

    • Track pigment composition modifications

    • Apply pathway enrichment analysis to identify metabolic perturbations

Validation strategies:

  • Genetic complementation:

    • Reintroduce wildtype or mutated CAB-M9 variants

    • Test rescue of phenotypic and molecular alterations

    • Use dose-dependent complementation to establish causality

  • Protein-interaction verification:

    • Perform ChIP-seq or RNA immunoprecipitation for regulatory interactions

    • Use proximity labeling (BioID, APEX) to identify physical interaction partners

    • Validate direct interactions through in vitro binding assays

The table below summarizes a decision framework for classifying effects:

ObservationDirect effect indicatorsIndirect effect indicators
TimingRapid response (minutes to hours)Delayed response (days)
ComplementationImmediate rescue with CAB-M9 reintroductionGradual or partial rescue
Dose-dependencyProportional to CAB-M9 expression levelThreshold effects or non-linear responses
Physical interactionDemonstrated binding or proximitySeparated by multiple intermediates in pathway
ConsistencyConserved across multiple genetic backgroundsHighly variable between backgrounds

For experimental design, researchers should implement genetic controls including:

  • Multiple independent knockout/knockdown lines to control for insertion effects

  • Knockout of related CAB family members to identify specificity of effects

  • Controlled environmental conditions to minimize unrelated stress responses

  • Multiple reference genes for expression normalization to avoid circular analysis

By integrating these approaches, researchers can build confidence in distinguishing the direct consequences of CAB-M9 perturbation from secondary effects that propagate through the cellular network.

What are the most common pitfalls in purifying active recombinant CAB-M9 and how can they be addressed?

Purifying active recombinant CAB-M9 presents several challenges that can be systematically addressed:

Challenge 1: Inclusion body formation in bacterial expression

  • Causes: Overexpression, improper folding, hydrophobic transmembrane regions

  • Solutions:

    • Reduce expression temperature to 16-20°C

    • Lower inducer concentration (0.1-0.2 mM IPTG instead of 1 mM)

    • Use specialized strains (Origami, C41/C43) for membrane proteins

    • Co-express with molecular chaperones (GroEL/GroES, trigger factor)

    • Fuse with solubility-enhancing tags (MBP, SUMO, Trx)

Challenge 2: Protein instability during purification

  • Causes: Detergent-induced denaturation, oxidation, proteolysis

  • Solutions:

    • Screen multiple mild detergents (DDM, LDAO, Fos-choline-12)

    • Include antioxidants (5 mM DTT or 1 mM TCEP) in all buffers

    • Add protease inhibitor cocktail throughout purification

    • Maintain strict temperature control (4°C throughout)

    • Add glycerol (10-20%) to stabilize native conformation

Challenge 3: Loss of chlorophyll binding capacity

  • Causes: Improper refolding, denaturation during purification

  • Solutions:

    • Add chlorophyll during protein refolding process

    • Use native electrophoresis to confirm pigment-protein complex formation

    • Reconstitute protein in liposomes containing native chloroplast lipids

    • Purify under green light to minimize photodamage

    • Validate function through spectroscopic analysis of chlorophyll binding

Challenge 4: Low yield and purity

  • Causes: Poor expression, aggregation, co-purification of contaminants

  • Solutions:

    • Optimize codon usage for expression host

    • Implement two-step affinity purification (tandem tags)

    • Include ion exchange chromatography step to remove host proteins

    • Apply size exclusion chromatography as final polishing step

    • Use on-column refolding for proteins recovered from inclusion bodies

The following table summarizes a systematic troubleshooting approach:

IssueDiagnostic approachCorrective actionValidation method
Poor solubilitySDS-PAGE of soluble/insoluble fractionsAdjust expression conditions, add solubility tagsIncreased protein in soluble fraction
AggregationSize exclusion profile, dynamic light scatteringScreen detergents, optimize buffer conditionsMonodisperse SEC peak, uniform DLS profile
Low puritySDS-PAGE, western blotAdditional purification steps, stringent washingSingle band on silver-stained gel
Inactive proteinAbsorption spectroscopy, chlorophyll binding assayGentle refolding, reconstitution with pigmentsRed-shifted absorption spectrum

For effective production of active CAB-M9, implement an experimental design approach:

  • Test multiple expression constructs in parallel (varying tags, positions, linkers)

  • Screen purification conditions using factorial design

  • Validate protein activity using multiple complementary assays

  • Benchmark against native protein isolated from maize when possible

How can I optimize experimental conditions to study CAB-M9 structure-function relationships?

Optimizing experimental conditions for CAB-M9 structure-function studies requires balancing between physiological relevance and experimental feasibility:

Structural characterization optimization:

  • X-ray crystallography:

    • Screen detergent:protein ratios systematically (typically 1:1 to 3:1)

    • Test lipid cubic phase crystallization for membrane protein stability

    • Include chlorophyll during crystallization to stabilize native conformation

    • Try crystallization with antibody fragments to increase polar surface area

  • Cryo-electron microscopy:

    • Optimize grid preparation (blotting time, chamber humidity)

    • Test multiple support films (continuous carbon, graphene oxide)

    • Screen buffer conditions to prevent preferential orientation

    • Consider reconstitution in nanodiscs for uniform particle distribution

  • NMR spectroscopy:

    • Isotopic labeling strategies (uniform 15N/13C, selective methyl labeling)

    • Detergent screening for optimal spectral quality

    • Deuteration to reduce relaxation and improve resolution

    • Fragment-based approaches for transmembrane versus soluble domains

Functional assay optimization:

  • Energy transfer measurements:

    • Optimize reconstitution conditions (protein:chlorophyll ratio, lipid composition)

    • Control temperature precisely (±0.1°C) during measurements

    • Minimize exposure to actinic light before measurements

    • Include oxygen scavenging system to prevent photooxidation

  • Protein stability assessment:

    • Monitor thermal stability across pH range (5.5-8.0)

    • Measure stability in different ionic strength conditions (50-500 mM)

    • Test compatibility with various membrane mimetics (detergents, liposomes, nanodiscs)

    • Assess long-term stability at storage temperature over multiple time points

Experimental design matrix for optimization:

ParameterVariables to testAnalysis methodSuccess criteria
Buffer pH6.0, 6.5, 7.0, 7.5, 8.0Thermal stability, activity assaysHighest Tm while maintaining function
Salt type/concentrationNaCl, KCl at 50, 150, 300 mMSize exclusion chromatography, DLSMonodisperse preparation, minimal aggregation
Detergent typeDDM, LMNG, OG, LDAOProtein yield, spectroscopic integrityHighest yield with native-like spectra
Lipid compositionMGDG:DGDG:SQDG:PG ratiosReconstitution efficiency, functionMatching native thylakoid activity
Protein:pigment ratio1:3, 1:5, 1:7, 1:10Absorption spectra, fluorescenceSaturation of binding sites without aggregation

Statistical approach for optimization:

  • Initial broad screening using sparse matrix design

  • Refined optimization using response surface methodology

  • Robustness testing by deliberate parameter variation

  • Validation across multiple protein preparations

When reporting optimized conditions, researchers should provide detailed protocols including:

  • Buffer composition with exact pH measurement temperature

  • Detergent type, concentration, and critical micelle concentration

  • Protein concentration determination method and estimated error

  • Complete spectroscopic characterization of the final preparation

This systematic approach maximizes the likelihood of generating physiologically relevant structural and functional data while maintaining experimental reproducibility.

What are the best approaches for validating CAB-M9 knockout/knockdown specificity in Zea mays?

Validating CAB-M9 knockout/knockdown specificity in Zea mays requires comprehensive controls to ensure observed phenotypes result specifically from CAB-M9 perturbation:

Genetic validation approaches:

  • Multiple independent knockout/knockdown lines:

    • Generate at least 3 independent transgenic events

    • Use different target sequences for CRISPR/RNAi approaches

    • Verify consistent phenotypes across all lines

    • Quantify knockout/knockdown efficiency in each line

  • Complementation testing:

    • Reintroduce CAB-M9 under native or inducible promoter

    • Include both wildtype and functionally critical mutant versions

    • Demonstrate dose-dependent phenotype rescue

    • Use tissue-specific promoters to establish site of action

  • Off-target effect assessment:

    • Perform whole-genome sequencing of knockout lines

    • Analyze potential off-target sites for CRISPR through computational prediction

    • Verify integrity of closely related genes through targeted sequencing

    • Use heterozygotes as intermediates to establish dose-dependency

Molecular validation methods:

  • Transcript analysis:

    • qRT-PCR with multiple primer sets targeting different exons

    • RNA-seq to quantify full transcript abundance

    • 5' and 3' RACE to detect truncated transcripts or alternative splicing

    • Northern blotting to visualize transcript size and abundance

  • Protein verification:

    • Western blotting with antibodies targeting different epitopes

    • Mass spectrometry-based targeted proteomics

    • Immunolocalization to confirm absence in expected tissues

    • Activity assays to verify functional knockout

  • Compensatory response assessment:

    • Measure expression of all CAB family members

    • Quantify related light-harvesting proteins

    • Analyze thylakoid protein composition through BN-PAGE

    • Assess photosystem stoichiometry and organization

The table below outlines a comprehensive validation framework:

Validation levelMethodsControlsAcceptance criteria
GeneticGenotyping PCR, sequencingWild-type, heterozygoteConfirmed mutation, no off-target changes
TranscriptqRT-PCR, RNA-seqMultiple reference genes, related CAB genes>90% reduction, no significant changes in related genes
ProteinWestern blot, proteomic analysisLoading controls, tissue samples from wildtypeUndetectable target protein, no nonspecific alterations
FunctionalChlorophyll binding capacity, photosynthetic parametersWild-type under identical conditionsSpecific alterations in expected parameters
PhysiologicalGrowth, yield, stress responsesWild-type, knockouts of related genesPhenotype consistent with proposed function

Experimental design considerations:

  • Include proper randomization and blinding in phenotypic assessments

  • Grow knockout and control plants side-by-side under identical conditions

  • Conduct experiments across multiple generations to ensure stable inheritance

  • Test phenotypes under varied environmental conditions to assess specificity

  • Apply rigorous statistical analysis with appropriate multiple testing correction

By implementing this multi-level validation strategy, researchers can establish with high confidence that observed phenotypes result specifically from CAB-M9 perturbation rather than off-target effects or compensatory responses.

What are the current gaps in CAB-M9 research and promising future directions?

Current research on Recombinant Zea mays Chlorophyll a-b binding protein M9, chloroplastic (CAB-M9) presents several knowledge gaps and emerging opportunities:

Current research gaps:

  • Structural characterization:

    • High-resolution structures of CAB-M9 in different functional states remain elusive

    • Dynamic structural changes during energy transfer are poorly understood

    • Lipid-protein interactions at molecular level need further elucidation

  • Regulatory networks:

    • Transcriptional and post-transcriptional control mechanisms specific to CAB-M9

    • Signaling pathways connecting environmental cues to CAB-M9 expression

    • Protein turnover and degradation pathways in response to stress

  • Evolutionary context:

    • Functional diversification among CAB family members in monocots

    • Selective pressures driving CAB-M9 conservation or divergence

    • Convergent/divergent evolution in C3 versus C4 photosynthetic systems

  • Physiological significance:

    • Specific contribution to maize photosynthetic efficiency

    • Role in photoprotection mechanisms beyond light harvesting

    • Impact on crop resilience under changing climate conditions

Promising future directions:

  • Integrated structural biology approaches:

    • Combining cryo-EM, crystallography, and molecular dynamics simulations

    • Time-resolved structural studies capturing energy transfer intermediates

    • In situ structural characterization within native membrane environments

  • Advanced genetic engineering:

    • CRISPR-based precise editing of regulatory and functional domains

    • Optogenetic control of CAB-M9 expression or activity

    • Engineering enhanced photosynthetic efficiency through rational CAB-M9 modifications

  • Systems biology integration:

    • Multi-omics approaches connecting genotype to phenotype

    • Network modeling of light harvesting complex assembly and regulation

    • Quantitative models of energy transfer incorporating CAB-M9 dynamics

  • Translation to agricultural applications:

    • Biomarker development for photosynthetic efficiency in breeding programs

    • Engineering stress-tolerant variants for climate resilience

    • Optimizing canopy architecture for light harvesting efficiency

The most promising intersectional research would combine structural insights with functional genomics and physiological studies to establish clear structure-function relationships at multiple biological scales, from molecular interactions to whole-plant phenotypes and ultimately crop productivity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.