Recombinant Zea mays Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Zea mays Chloroplast Envelope Membrane Protein (cemA)

Recombinant Zea mays Chloroplast Envelope Membrane Protein (cemA) is a genetically engineered transmembrane protein derived from maize (Zea mays). It plays a critical role in chloroplast membrane integrity and ion transport . The recombinant form is produced using E. coli expression systems, enabling large-scale studies of its structural and functional properties .

Gene and Protein Information

  • Gene Name: cemA (synonym: ycf10)

  • UniProt ID: P46641

  • Protein Length: 230 amino acids (full-length)

Physicochemical Properties

PropertyValue
Molecular Weight~24.6–26.6 kDa
Isoelectric Point (pI)6.18–7.77
Stability Index19.75–32.27
Aliphatic Index87.59–96.26
Hydropathicity (GRAVY)-0.108 to +0.163
DomainsCupin domain (structural motif)

Expression System

  • Host: Escherichia coli (E. coli)

  • Tag: N-terminal 10xHis tag for affinity purification

  • Form: Lyophilized powder or glycerol-stabilized liquid

Biological Role

cemA facilitates chloroplast envelope membrane biogenesis and interacts with thylakoid-bound ribosomes during cotranslational protein integration . It distinguishes sorting signals for thylakoid vs. envelope membranes, critical for plastid function .

Research Applications

  • Proteomics: Detected in maize PeptideAtlas builds (e.g., V5_Zea_Mays_B73_core_proteome.fa) .

  • Mechanistic Studies: Used to explore chloroplast protein-targeting pathways .

  • Biophysical Assays: SDS-PAGE analysis confirms >90% purity .

Maize PeptideAtlas Coverage (2023)

Genome ComponentObserved ProteinsCanonical Core Proteins
Plastidial41/111 (36.9%)18.9% redundancy
Nuclear Chromosomes16,178/40,03040.4% coverage

Challenges and Future Directions

  • Limitations: Low solubility in non-denaturing buffers .

  • Research Gaps: Functional validation of predicted phosphorylation (1–2 sites) and glycosylation motifs .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your needs when placing the order. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
cemA; ycf10; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
cemA
Target Protein Sequence
MKKKKALPSFLYLVFIVLLPWGVSFSFNKCLELWIKNWWNTRQSETFLTDIQEKRILEGF IELEELFLLDEMIKEKPKTHVQKLPIGIHKEIIQLAKIDNEDHLHIILHFSTNIICLAIL SGSFFLGKEELVILNSWVQEFFYNLNDSIKAFFILLVTDFFVGFHSTRGWELLIRWVYNN LGWAPNELIFTIFVCSFPVILDTCLKFWVFFCLNRLSPSLVVIYHSISEA
Uniprot No.

Target Background

Function
May be involved in proton extrusion. Indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Database Links
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the chloroplast envelope membrane protein (cemA) in Zea mays?

The chloroplast envelope membrane protein (cemA) in Zea mays is a protein encoded by the chloroplast genome that plays essential roles in chloroplast function and photosynthetic processes. As a component of the chloroplast envelope membrane system, it contributes to the regulation of molecular transport between the chloroplast and cytosol. The study of cemA in maize benefits from the extensive genetic resources available for this crop, including a vast collection of mutant stocks and extensive nucleotide diversity . Methodologically, researchers identify and characterize cemA through comparative genomic analysis against other well-studied plants like rice (Oryza sativa) and sorghum (Sorghum bicolor), leveraging the genic colinearity observed within related grasses.

How is recombinant Zea mays cemA typically expressed for research purposes?

Recombinant expression of Zea mays cemA typically employs heterologous expression systems optimized for membrane proteins. Similar to approaches used for other plant membrane proteins, research methodologies involve:

  • Gene isolation from maize chloroplast DNA

  • Cloning into appropriate expression vectors

  • Expression in systems such as E. coli, yeast, or plant-based systems

The selection of an expression system depends on research objectives, with considerations similar to those used for other recombinant proteins. The table below outlines common expression systems and their characteristics for cemA expression:

Expression SystemAdvantagesLimitationsOptimal Applications
E. coliHigh yield, rapid growth, economicalLimited post-translational modificationsInitial characterization, antibody production
Yeast (P. pastoris)Eukaryotic folding machinery, moderate yieldMore complex cultivation requirementsStructural studies requiring proper folding
Plant expression systemsNative-like post-translational modificationsLower yield, longer timeframeFunctional studies requiring authentic modifications
Cell-free systemsAvoids toxicity issues, rapidHigher cost, lower yieldDifficult-to-express variants

What protocols are recommended for purification of recombinant Zea mays cemA?

Purification of recombinant Zea mays cemA requires specialized techniques due to its membrane protein nature. The recommended methodological approach includes:

  • Membrane isolation through differential centrifugation

  • Detergent solubilization (typically using mild detergents like DDM or LMNG)

  • Affinity chromatography (utilizing fusion tags)

  • Size exclusion chromatography for final purification

Researchers should optimize detergent concentration and buffer conditions through small-scale screening before proceeding to large-scale purification. These approaches leverage the extensive research experience gained from studying other plant membrane proteins, while accounting for the specific characteristics of maize as a model system .

What are the challenges in structural characterization of recombinant Zea mays cemA?

Structural characterization of recombinant Zea mays cemA faces several methodological challenges that require specialized approaches:

  • Protein stability issues: cemA, like many membrane proteins, tends to aggregate outside its native lipid environment. Researchers should employ stability screening using techniques like differential scanning fluorimetry to identify optimal buffer conditions.

  • Crystallization difficulties: Traditional X-ray crystallography approaches often fail with membrane proteins. Alternative methodologies include:

    • Lipidic cubic phase crystallization

    • Cryo-electron microscopy (cryo-EM)

    • Nuclear magnetic resonance (NMR) for specific domains

  • Expression yield limitations: Low expression yields can hamper structural studies. Methodological solutions include fusion with stability-enhancing tags (such as BRIL or T4 lysozyme) and screening multiple constructs with varying termini.

  • Reconstitution into membrane mimetics: Selection of appropriate membrane mimetics (detergents, nanodiscs, or liposomes) is crucial for maintaining native-like conformations.

The systematic approach to addressing these challenges has been informed by the extensive genetic and genomic research conducted in maize as a model organism .

How can researchers investigate cemA protein-protein interactions in Zea mays chloroplasts?

Investigation of cemA protein-protein interactions requires specialized methodologies that account for the membrane-embedded nature of the protein:

  • Co-immunoprecipitation (Co-IP): Using cemA-specific antibodies to pull down interaction partners, followed by mass spectrometry identification. Methodologically, this requires:

    • Generation of specific antibodies against recombinant cemA

    • Optimization of solubilization conditions to maintain interactions

    • Careful selection of controls to distinguish specific from non-specific interactions

  • Proximity labeling approaches: Methods such as BioID or APEX2 fusion systems can identify proximal proteins in vivo. The research protocol includes:

    • Generation of cemA-BioID or cemA-APEX2 fusion constructs

    • Transformation into maize or model plant systems

    • Biotin labeling and affinity purification of labeled proteins

    • Mass spectrometry identification of interacting partners

  • Förster resonance energy transfer (FRET): For confirming direct interactions with candidate proteins:

    • Creation of fluorescent protein fusions

    • Transient expression in protoplasts

    • FRET efficiency measurements using confocal microscopy

These approaches leverage the extensive genetic resources available for maize, including transformation systems and mutant stocks that facilitate functional genomic studies .

What experimental designs are recommended for investigating cemA function in Zea mays photosynthesis?

Investigating cemA function in Zea mays photosynthesis requires comprehensive experimental designs that isolate its specific contribution:

  • Genetic approach using CRISPR-Cas9 technology:

    • Generation of cemA knockout or knockdown lines

    • Complementation with wild-type or mutated versions

    • Phenotypic characterization of photosynthetic parameters

  • Physiological measurements:

    • Gas exchange analysis to measure CO₂ assimilation rates

    • Chlorophyll fluorescence to assess PSII efficiency

    • P700 absorbance to evaluate PSI functionality

  • Biochemical characterization:

    • Thylakoid membrane isolation and analysis

    • Blue-native PAGE to assess complex formation

    • In vitro reconstitution studies to test specific functions

  • Comparative analysis across conditions:

    • Response to varying light intensities

    • Temperature stress responses

    • Nutrient limitation effects

The table below summarizes recommended photosynthetic measurements for cemA functional characterization:

Measurement TechniqueParametersInformation ObtainedTechnical Requirements
Gas exchangeA/Ci curves, light responsePhotosynthetic capacity, limitationsIRGA system, controlled environment
Chlorophyll fluorescenceFv/Fm, NPQ, ETRPSII efficiency, photoprotectionPAM fluorometer
P700 measurementsP700⁺ re-reduction kineticsPSI functionality, cyclic electron flowDual-wavelength spectrophotometer
Electrochromic shiftProton motive forceThylakoid energizationSpecialized spectrophotometer

This integrated approach builds on the extensive research history of maize as a model organism for studies of photosynthesis and developmental physiology .

What expression vector systems are most effective for recombinant Zea mays cemA production?

For effective recombinant expression of Zea mays cemA, the selection of appropriate vector systems is critical:

  • Bacterial expression vectors:

    • pET series vectors with T7 promoter for high-level expression

    • pMAL or pGEX for fusion protein production (MBP or GST fusions)

    • pBAD vectors for tunable expression under araBAD promoter

  • Yeast expression vectors:

    • pPICZ series for Pichia pastoris expression

    • pYES2 for galactose-inducible expression in Saccharomyces cerevisiae

  • Plant-based expression systems:

    • pCAMBIA vectors for Agrobacterium-mediated transformation

    • Viral vectors (TMV or PVX-based) for transient expression

The methodological approach should include testing multiple constructs with varying:

  • N- and C-terminal fusion tags

  • Promoter strengths

  • Signal peptides for appropriate targeting

  • Codon optimization for the chosen expression host

This systematic approach to vector design and selection builds on extensive experience with heterologous protein expression in maize and other plant systems .

How can researchers troubleshoot protein folding issues when expressing recombinant Zea mays cemA?

Addressing protein folding challenges for recombinant Zea mays cemA requires a systematic troubleshooting approach:

  • Modification of expression conditions:

    • Temperature reduction during induction (16-20°C)

    • Slower induction using lower inducer concentrations

    • Adjustment of media composition and growth phase at induction

  • Co-expression strategies:

    • Molecular chaperones (GroEL/GroES, DnaK/DnaJ)

    • Specific chloroplast protein folding factors

    • Disulfide bond formation facilitators when applicable

  • Fusion partner approaches:

    • Solubility-enhancing partners (MBP, SUMO, Trx)

    • Specialized membrane protein fusion partners (Mistic, BRIL)

    • Inclusion of flexible linkers between fusion partner and target

  • Alternative solubilization methods:

    • Detergent screening matrix (ionic, non-ionic, zwitterionic)

    • Amphipol or SMA polymer solubilization

    • Nanodiscs or liposome reconstitution

The table below outlines recommended troubleshooting approaches based on observed issues:

Observed IssuePrimary InterventionSecondary ApproachesAnalysis Method
Low expressionCodon optimization, vector redesignAlternative host systemsWestern blot, fluorescence
Inclusion bodiesReduced temperature, slower inductionFusion partners, refolding protocolsSDS-PAGE, solubility tests
MisfoldingChaperone co-expressionMembrane mimetics optimizationCircular dichroism, activity assays
AggregationDetergent screeningStabilizing additivesSize exclusion chromatography

This methodological framework draws upon the extensive experience in handling difficult-to-express proteins in various research contexts .

What techniques are recommended for analyzing cemA integration into chloroplast membranes?

Analyzing cemA integration into chloroplast membranes requires specialized techniques that assess both localization and functional integration:

  • Membrane fractionation approaches:

    • Differential and density gradient centrifugation to isolate pure chloroplast membrane fractions

    • Western blot analysis using anti-cemA antibodies

    • Protease protection assays to determine topology

  • Microscopy-based methods:

    • Confocal microscopy with fluorescent protein fusions

    • Immunogold electron microscopy for high-resolution localization

    • FRAP (Fluorescence Recovery After Photobleaching) to assess mobility within membranes

  • Biochemical characterization:

    • Liposome reconstitution assays to test integration capacity

    • Blue-native PAGE to assess complex formation

    • Crosslinking studies to identify neighboring proteins

  • Biophysical techniques:

    • Atomic force microscopy of membrane preparations

    • Solid-state NMR for structural analysis in membrane environment

    • Surface plasmon resonance for interaction studies

These methodological approaches can be applied within the context of maize as a model organism, taking advantage of its extensive genetic resources and the well-established protocols for chloroplast isolation and analysis .

How does Zea mays cemA function compare with cemA in other plant species?

Comparative analysis of cemA function across plant species provides valuable evolutionary and functional insights:

  • Sequence-based comparative analysis:

    • Multiple sequence alignment of cemA from diverse plant species

    • Identification of conserved domains and species-specific variations

    • Evolutionary rate analysis to identify selection pressures

  • Functional complementation studies:

    • Expression of cemA from different species in cemA-deficient backgrounds

    • Assessment of restoration of photosynthetic function

    • Identification of species-specific functional differences

  • Structural comparison methodologies:

    • Homology modeling based on available structures

    • Molecular dynamics simulations in membrane environments

    • Identification of species-specific structural adaptations

This comparative approach builds on the position of maize as a centerpiece for comparative genomics research within the cereals and related grasses . The genic colinearity observed between maize and other plant species facilitates these comparative analyses.

What data analysis methods are recommended for resolving contradictory findings in cemA functional studies?

Resolving contradictory findings in cemA research requires robust data analysis methodologies:

  • Meta-analysis approaches:

    • Systematic review of existing literature

    • Statistical synthesis of quantitative data

    • Identification of methodological differences that may explain contradictions

  • Multivariate data analysis:

    • Principal component analysis to identify major sources of variation

    • Cluster analysis to identify patterns in experimental results

    • Correlation analysis between experimental conditions and outcomes

  • Bayesian modeling frameworks:

    • Integration of prior knowledge with new experimental data

    • Quantification of uncertainty in experimental results

    • Model comparison to evaluate competing hypotheses

  • Reproducibility assessment:

    • Standardization of experimental protocols

    • Independent replication in multiple laboratories

    • Preregistration of research designs to minimize bias

This methodological framework for resolving contradictions is especially important in complex biological systems like maize, where genetic background effects and environmental interactions can significantly influence experimental outcomes .

What emerging technologies hold promise for advanced cemA functional characterization?

Several emerging technologies offer new opportunities for cemA research:

  • Single-molecule approaches:

    • Single-molecule FRET to analyze conformational changes

    • Single-molecule force spectroscopy to assess protein stability

    • Super-resolution microscopy for precise localization

  • Advanced genetic tools:

    • Prime editing for precise modification of cemA sequence

    • Optogenetic control of cemA function

    • Synthetic biology approaches to create cemA variants

  • Integrative structural biology:

    • Cryo-electron tomography of chloroplast membranes

    • Integrative modeling combining multiple data sources

    • AlphaFold2 and similar AI-based structure prediction

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Flux balance analysis of photosynthetic processes

    • Network modeling of chloroplast protein interactions

These advanced methodologies can build upon the extensive genetic and genomic resources available for maize research, enabling more comprehensive understanding of cemA function in photosynthesis and chloroplast biology .

How can researchers design experiments to investigate cemA's role in environmental stress responses?

Investigating cemA's role in stress responses requires carefully designed experimental approaches:

  • Controlled environment studies:

    • Precise manipulation of light, temperature, and CO₂ conditions

    • Measurement of photosynthetic parameters under stress

    • Comparison between wild-type and cemA-modified lines

  • Field-based experiments:

    • Multi-location trials to assess genotype-by-environment interactions

    • High-throughput phenotyping under natural stress conditions

    • Long-term studies to capture seasonal variations

  • Molecular response profiling:

    • Transcriptomic analysis under various stress conditions

    • Quantitative proteomics to assess protein level changes

    • Post-translational modification analysis

  • Physiological measurements:

    • Chlorophyll fluorescence imaging under stress

    • Gas exchange measurements at varying stress intensities

    • Reactive oxygen species detection and quantification

The table below outlines a recommended experimental design framework:

Environmental StressControl ConditionsStress Treatment LevelsKey MeasurementsExpected Timeline
High light200-300 μmol m⁻² s⁻¹800, 1200, 1600 μmol m⁻² s⁻¹NPQ, ROS production, PSII damageShort-term (hours to days)
Heat stress25°C35°C, 40°C, 45°CMembrane integrity, electron transportMedium-term (days)
DroughtWell-wateredModerate, severe water deficitWater use efficiency, ABA responsesLong-term (weeks)
Combined stressesControl conditionsFactorial combination of aboveIntegrated stress responsesVarious timepoints

This experimental framework leverages maize's position as a model organism for studies of stress physiology and adaptation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.