Recombinant Zea mays Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPTGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of PetD in the Cytochrome b6-f complex?

PetD serves as a critical structural and functional component of the Cytochrome b6-f complex in maize. It forms a mildly protease-resistant subcomplex with Cytochrome b6 that serves as a template for the assembly of other components, including Cytochrome f and PetG, ultimately producing a protease-resistant cytochrome moiety . This subcomplex is prerequisite for the synthesis of Cytochrome f, as evidenced by reduced synthesis of Cytochrome f when PetD is inactivated . The complex plays a crucial role in photosynthesis by mediating electron transfer and also activates the state-transition kinase (STT7), which phosphorylates light-harvesting complex proteins .

How can I verify the integrity of recombinant PetD protein?

Integrity verification of recombinant PetD can be performed through multiple complementary approaches:

  • Optical spectroscopy: Measure the protein at room temperature using a diode array spectrophotometer. Compare oxidized samples (using potassium ferricyanide) with fully reduced samples (using sodium dithionite) .

  • Electron paramagnetic resonance (EPR) spectroscopy: Record spectra at low temperature (approximately 10K) on appropriate spectrometers equipped with liquid helium measurements. For comparative analysis, prepare both oxidized and partially reduced samples .

  • SDS-PAGE and immunoblotting: Use antibodies specific to PetD to confirm molecular weight and protein expression.

  • Activity measurements: Assess the functionality of the Cytochrome b6-f complex by measuring complex-mediated reduction of plastocyanin (PC). For example, one validated method shows a turnover rate of approximately 120 per second using decylplastoquinol (dPQH2) as substrate .

What are the common expression systems for producing recombinant Zea mays PetD?

Several expression systems can be employed for the production of recombinant maize PetD, each with distinct advantages:

  • E. coli expression systems: Commonly used for initial characterization due to rapid growth and high yield. This approach was successfully employed in studies examining recombinant protein function in kinase inhibition assays .

  • Biolistic transformation of Chlamydomonas reinhardtii: An effective system for chloroplast transformation using plasmids containing modified PetD gene versions along with a selection marker (e.g., aadA cassette conferring spectinomycin resistance at 150 µg/ml) .

  • Homologous expression in maize: While more challenging, this provides proper post-translational modifications and can be achieved through appropriate vector construction containing the targeted gene region (e.g., petD/trnR1 region with 481 bp upstream and 1032 bp downstream of petD) .

The choice of expression system should be guided by the specific experimental questions and downstream applications.

How can I identify PetD in complex maize protein samples?

Identification of PetD in complex samples can be achieved through mass spectrometry-based proteomics approaches, with the Maize PeptideAtlas serving as a valuable resource:

  • Tandem mass spectrometry (MS/MS): Submit samples for analysis using data-dependent acquisition (DDA) methods. The Maize PeptideAtlas has processed 445 million MS/MS spectra, of which 120 million matched to distinct peptides .

  • Database search: Use comprehensive protein search spaces that include multiple maize genome annotations. The Maize PeptideAtlas incorporates sequences from various sources including MaizeGDB, UniProtKB, and NCBI RefSeq for the B73 and W22 inbred lines .

  • Peptide mapping: PetD can be identified through unique peptide signatures that distinguish it from other proteins. The Maize PeptideAtlas has mapped peptides to 66.2% of proteins in the most recent B73 nuclear genome annotation (v5) .

  • Post-translational modification analysis: The Maize PeptideAtlas also enables identification of modifications including N-terminal acetylation, phosphorylation, ubiquitination, and lysine acylations (K-acetyl, K-malonyl, K-hydroxybutyryl) that may be present on PetD .

What methodologies can be used to study the assembly dynamics of PetD into the Cytochrome b6-f complex?

The assembly dynamics of PetD can be investigated through several sophisticated approaches:

  • Blue Native PAGE (BN-PAGE) analysis: This technique can separate the intact complex in its various assembly states. As demonstrated in research on mutant plants, BN-PAGE can distinguish between dimers, monomers, and intermediate forms of the Cytochrome b6-f complex. The ratio between monomer and dimer forms provides insight into assembly efficiency .

  • Pulse-chase labeling with immunoprecipitation: This method enables tracking of newly synthesized PetD and its incorporation into the complex:

    • Pulse label with radioactive amino acids for defined periods (e.g., 10 min and 30 min)

    • Chase with non-radioactive amino acids

    • Immunoprecipitate with anti-PetD antibodies

    • Analyze by SDS-PAGE and autoradiography

    • Perform multiple rounds of immunoprecipitation to ensure complete recovery

  • Ribosome loading analysis: This approach can reveal altered translation initiation efficiency for PetD and other complex components .

  • Stability assessment using protein synthesis inhibitors: Treatment with lincomycin (an inhibitor of chloroplast protein synthesis) followed by immunoblotting at regular intervals (e.g., every 2 hours for up to 8 hours) can evaluate the stability of assembled PetD within the complex .

How can I design site-directed mutagenesis experiments to study functional domains of PetD?

Effective site-directed mutagenesis of PetD requires careful planning and execution:

  • Target selection:

    • The N-terminal region of PetD is essential for Cytochrome b6-f function

    • Design mutations based on sequence conservation analysis across species

    • Consider the structural proximity to other subunits like Cytochrome b6

  • Vector construction methodology:

    • Amplify the petD/trnR1 region (including regulatory elements) using restriction site-containing primers

    • Clone into an appropriate vector (e.g., pUC18)

    • Incorporate a selection marker (e.g., aadA cassette for spectinomycin resistance)

    • Create intermediate vectors to facilitate the final construct assembly

  • Transformation procedure:

    • For chloroplast transformation, use biolistic methods with plasmids containing modified petD versions

    • Select transformants using appropriate antibiotics

    • Confirm homoplasty through multiple rounds of selection and PCR verification

  • Functional assessment:

    • Test photoautotrophic growth by spotting cells on minimal medium plates

    • Assess complex assembly through BN-PAGE analysis

    • Measure electron transport activity through spectroscopic methods

    • Evaluate state transitions under different conditions (e.g., aerobic vs. anoxic)

What approaches can resolve contradictory data regarding PetD expression patterns in different maize inbred lines?

Resolving contradictory expression data requires systematic comparative analysis:

  • Standardized proteomics workflow:

    • Use uniform sample preparation protocols across different maize lines

    • Apply consistent MS acquisition parameters

    • Process data through a single, standardized pipeline as exemplified by the Maize PeptideAtlas approach

  • Cross-genotype comparison strategy:

    • Analyze different maize inbred lines in parallel (e.g., B73 and W22)

    • Map peptides to different genome annotations (e.g., MaizeGDB v3, v4, v5, RefSeq v4, RefSeq v5)

    • Identify single nucleotide polymorphisms (SNPs) that distinguish line-specific PetD variants

  • Comprehensive metadata annotation:

    Metadata ElementExample CategoriesImportance
    Genetic backgroundB73, W22, hybridsAccounts for genetic variation
    Tissue typeLeaf, root, endospermReveals tissue-specific expression
    Developmental stageSeedling, mature, senescentIdentifies temporal regulation
    Growth conditionsField trials, controlled environmentAccounts for environmental effects
    Stress treatmentsBiotic, abiotic stressorsReveals stress-responsive regulation
    Subcellular fractionThylakoid membrane, stromaConfirms localization
  • MS/MS spectra evaluation: Examine matched spectra counts across experiments as indicators of relative abundance. The cumulative number of matched MS/MS spectra can be plotted against distinct peptides identified to assess proteome coverage depth .

What are the most effective methods to study interactions between PetD and other components of the photosynthetic electron transport chain?

Several methodologies can be employed to study PetD interactions:

  • Co-immunoprecipitation with quantitative MS analysis:

    • Use anti-PetD antibodies to capture the protein and its interacting partners

    • Identify pulled-down proteins through MS analysis

    • Quantify interaction strengths through label-free or isotope-labeled approaches

    • Compare results across different physiological conditions

  • Crosslinking mass spectrometry (XL-MS):

    • Apply protein crosslinkers to stabilize transient interactions

    • Digest crosslinked complexes and analyze by MS

    • Map interaction interfaces at amino acid resolution

    • Validate findings through structural modeling

  • High-resolution cryo-electron microscopy (cryo-EM):

    • Recent advances have enabled visualization of the Cytochrome b6-f homodimer with endogenous plastoquinones and in complex with plastocyanin

    • This approach can reveal the spatial arrangement of PetD relative to other components

    • Studies have shown that three plastoquinones can line up one after another near the Q-p site in each monomer, indicating the existence of a channel

  • Mutant complementation assays:

    • Generate PetD mutants lacking specific interaction domains

    • Assess complex formation and function through biochemical and spectroscopic methods

    • Measure growth parameters under different light conditions

    • Evaluate the impact on state transitions, which are regulated by the Cytochrome b6-f complex through STT7 kinase activation

How can comparative genomics approaches enhance our understanding of PetD evolution in Zea mays subspecies?

Leveraging comparative genomics provides insights into PetD evolution:

  • Multi-subspecies sequence alignment:

    • Compare PetD sequences across Zea mays subspecies (mays, parviglumis, mexicana)

    • Identify conserved domains versus variable regions

    • Calculate selection pressure (dN/dS ratios) across different domains

  • Introgression analysis:

    • Examine genomic evidence of introgression from subspecies like mexicana into modern maize

    • Over 10% of the maize genome shows evidence of introgression from the mexicana genome, suggesting potential adaptive contributions

    • Determine if PetD loci show signatures of selective introgression

  • Structural variation investigation:

    • Analyze comparative assemblies (e.g., B73, Mo17, and mexicana genomes)

    • Identify structural rearrangements that might affect PetD expression or function

    • Studies have revealed high levels of diversity between these genomes, including Mb-size structural rearrangements

  • Mutation rate calculation:

    • The maize spontaneous mutation rate is estimated to be 2.17 × 10⁻⁸ to 3.87 × 10⁻⁸ per site per generation

    • Mutation rates show nonrandom distribution across the genome

    • Higher deleterious mutation rates are observed in pericentromeric regions, possibly due to differences in recombination frequency

    • Examine whether PetD loci are in regions with higher or lower mutation rates

What resources are available for maize PetD research beyond traditional databases?

Several specialized resources enhance maize PetD research:

  • The Maize PeptideAtlas: A comprehensive resource (www.peptideatlas.org/builds/maize) that provides:

    • Reprocessed MS/MS proteome data with detailed metadata

    • Integration with MaizeGDB and JBrowse tracks

    • PTM viewer for examining post-translational modifications

    • Access to 120 million matched spectra from 445 million total MS/MS spectra

  • MaizeGDB: The central maize community database (www.maizegdb.org) providing:

    • Different versions of B73 genome annotations (v3, v4, v5)

    • Integration with proteomic evidence

    • Gene expression data

    • Comparative genomic tools

  • NCBI RefSeq: Provides alternative annotations of maize genomes with distinct annotation methodologies, offering complementary gene models that may identify PetD variants missed in community annotations .

  • Specialized cross-compatibility databases: Resources tracking reproductive isolation loci like Tcb1-s (Teosinte crossing barrier1-s) provide insights into the evolution of reproductive isolation mechanisms in maize and its wild relatives, which may indirectly influence population genetics of genes like PetD .

How might emerging technologies further our understanding of PetD function in the coming years?

Emerging technologies promise to revolutionize PetD research:

  • Single-cell proteomics: Will enable examination of PetD expression and complex assembly at the individual cell level, revealing cell-to-cell variation within tissues.

  • Long-read sequencing technologies: Will improve genome assemblies across diverse maize lines, potentially revealing previously undetected structural variations affecting PetD.

  • Genome editing with CRISPR-Cas9: Will enable precise modification of PetD sequences to study structure-function relationships and create synthetic variants with enhanced properties.

  • In situ structural biology: Techniques like cryo-electron tomography will allow visualization of the Cytochrome b6-f complex in its native membrane environment, revealing contextual interactions not observed in isolated complexes.

  • Multi-omics integration platforms: Will facilitate the correlation of PetD protein expression with transcriptomic, metabolomic, and phenotypic data, providing a systems-level understanding of photosynthetic function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.