Recombinant Zea mays Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Zea mays Cytochrome b6 (petB)

Recombinant Zea mays Cytochrome b6 (petB) is a key photosynthetic protein engineered for research applications. It is a 215-amino acid polypeptide (UniProt ID: P05642) expressed in E. coli with an N-terminal His tag for purification . This protein forms part of the cytochrome b₆f complex, which mediates electron transfer between Photosystem II and I in chloroplasts, enabling ATP synthesis .

Role in Photosynthesis

The cytochrome b₆f complex, including petB:

  • Catalyzes plastoquinol oxidation and plastocyanin reduction, driving proton gradient formation .

  • Requires cooperative interactions with Rieske iron-sulfur protein (petC) and subunit IV (petD) .

Regulatory Mechanisms

  • RNA Chaperone Interactions: The BSF protein stabilizes petB transcripts and enhances petA/petD translation efficiency in Arabidopsis and maize .

  • Mutant Studies: bsf mutants show 80–90% reductions in cytochrome b₆f complex levels due to defective petA/petD translation .

Applications in Plant Science Research

  • Electron Transport Studies: Used to analyze photosynthetic efficiency in C4 plants like maize .

  • Antibody Production: Serves as an immunogen for polyclonal antibodies (e.g., AS18 4169) .

  • Structural Biology: Facilitates crystallization trials to study heme-protein interactions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development with the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 (petB) is a component of the cytochrome b6-f complex, which plays a crucial role in electron transfer between photosystem II (PSII) and photosystem I (PSI). This complex also mediates cyclic electron flow around PSI and state transitions.
Database Links
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Zea mays Cytochrome b6 (PetB) and what is its role in photosynthesis?

    Cytochrome b6 (PetB) is one of the core subunits of the cytochrome b6f (Cyt b6f) complex, a multisubunit protein complex located in chloroplast thylakoid membranes that is essential for photosynthetic electron transport. In maize (Zea mays), as in other plants, this complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI) . The Cyt b6f complex catalyzes the oxidation of plastoquinols and the reduction of plastocyanin, establishing the proton force required for ATP synthesis . PetB is a b-type/c?-type cytochrome containing three heme groups that play crucial roles in electron transfer within the complex .

  • Where is the petB gene located in maize and how is it organized?

    The petB gene in Zea mays is located in the chloroplast genome, not the nuclear genome. It is typically part of a polycistronic transcription unit (psbB-psbT-psbH-petB-petD) . This organization is common in plastid genomes where several genes are co-transcribed and then processed into mature, functional mRNAs. In maize, as in other plants, the expression of petB requires coordinated gene expression between the nucleus and chloroplast, as many assembly factors and regulatory proteins are nucleus-encoded .

  • What methods are commonly used to detect and quantify PetB protein in plant samples?

    Detection and quantification of PetB in plant samples typically employ the following methodologies:

    • Western blotting: Using specific antibodies against the N-terminal region of PetB, with recommended dilutions of 1:1000 to 1:5000 .

    • Blue native PAGE (BN-PAGE): For analysis of intact Cyt b6f complexes and subcomplexes .

    • Immunoprecipitation: To study protein-protein interactions involving PetB .

    • Pulse-chase labeling: To assess protein synthesis and stability, often using radioactive markers followed by immunoprecipitation .

    For quantification, researchers typically load defined amounts of chlorophyll (e.g., 0.75 μg) from thylakoid preparations, with samples denatured at 75°C (rather than boiling) to avoid aggregation of membrane proteins .

  • What is the expected molecular weight and location of PetB in maize chloroplasts?

    The PetB protein in Zea mays has an expected molecular weight of approximately 24 kDa . It is an integral membrane protein localized specifically to the thylakoid membranes within chloroplasts. During subcellular fractionation experiments, PetB co-purifies with thylakoid membrane fractions and can be distinguished between mesophyll (M) and bundle sheath (BS) thylakoids in C4 plants like maize, where electron transport components show differential distribution between these cell types .

Advanced Research Questions

  • What factors are involved in the assembly of the cytochrome b6f complex in maize?

    The assembly of the Cyt b6f complex in maize and other plants involves multiple nuclear-encoded factors:

    • NTA1 (New Tiny Albino 1): A nucleus-encoded thylakoid membrane protein that directly interacts with four Cyt b6f subunits (PetB, PetD, PetG, and PetN) through its DUF1279 domain and C-terminal sequence to mediate their assembly. Loss of NTA1 results in severe defects in Cyt b6f accumulation and chloroplast development .

    • BSF (PetB/petD Stabilizing Factor): An RNA chaperone-like protein that stabilizes processed transcripts of petB and stimulates the translation of petD and petA mRNAs .

    • DAC (Defective Accumulation of Cyt b6f): A thylakoid membrane protein involved in the assembly/stabilization of Cyt b6f by interacting with the PetD subunit .

    • HCF164 and HCF222: Proteins that modulate Cyt b6f levels through their disulfide reductase activities .

    The assembly process follows a specific order: Cyt b6 (PetB) and PetD first form a protease-resistant subcomplex that serves as a template for the assembly of Cyt f and PetG, producing a protease-resistant cytochrome moiety. Subsequently, PetC and PetL participate in the assembly of the functional dimer .

  • How can recombinant Zea mays PetB be expressed and purified for structural and functional studies?

    Recombinant expression of Zea mays PetB typically involves the following methodological approaches:

    • Two-plasmid expression system: As described for cytochrome bc1 complexes, this involves separate plasmids carrying different subunits with different antibiotic resistance markers (e.g., Kan^R and Tet^R) .

    • Fusion protein approaches: For cytochrome b proteins, researchers have successfully used fusion constructs with linker sequences. For example, a petB fusion plasmid with a 12-amino acid (ASIAGGRTASGP) linker and a Strep tag at the C-terminus for purification .

    • Host systems: While E. coli can be used as an initial expression host, transfer to photosynthetic bacterial systems (e.g., R. capsulatus) may be necessary for proper folding and cofactor incorporation .

    Expression of functional PetB requires attention to heme incorporation, as defects in heme binding result in low accumulation of Cyt b6 . Purification typically involves membrane solubilization followed by affinity chromatography using added tags.

  • What molecular interactions occur between PetB and other components of the cytochrome b6f complex?

    PetB (Cyt b6) forms specific interactions with several components of the Cyt b6f complex:

    • Direct interactions with PetD: PetB and PetD form a core subcomplex that is resistant to mild protease treatment, serving as a template for subsequent assembly steps .

    • Interactions with small subunits: PetB interacts with PetG and PetN, as demonstrated by yeast two-hybrid assays, pull-down experiments, and co-immunoprecipitation studies with NTA1 .

    • Interactions with assembly factors: NTA1 interacts directly with PetB through specific domains, facilitating complex assembly .

    • Interactions with FNR: Ferredoxin-NADP+ reductase (FNR) can associate with the Cyt b6f complex, potentially facilitating cyclic electron transport. This interaction appears to involve specific docking sites on the complex .

    These interactions are critical for both the structural integrity of the complex and its functional role in electron transport.

  • How do mutations in petB affect photosynthetic efficiency and what are the phenotypic consequences?

    Mutations in the petB gene lead to significant effects on photosynthesis and plant development:

    • Photosynthetic electron transport: Defects in PetB cause severe impairment of electron transport between PSII and PSI, reducing photosynthetic efficiency .

    • Complex accumulation: Mutations often result in reduced accumulation or complete absence of the Cyt b6f complex. In the nta1 mutant of Arabidopsis, PetB protein levels were reduced to approximately 1% of wild-type levels .

    • Phenotypic consequences: Plants with defective PetB typically show albino or pale green phenotypes, severely impaired growth, and defects in chloroplast development . In extreme cases, mutations are lethal due to the essential nature of photosynthesis.

    • Secondary effects: Loss of Cyt b6f function can lead to secondary reductions in other photosynthetic complexes (PSI and PSII) due to altered photosynthetic redox control and modified retrograde signaling .

    Similar effects are observed in other organisms - for example, mutations in the mitochondrial cytochrome B gene in sheep cause anemia, organ malfunction, mineral status disruption, debility with exercise intolerance, and cardiomyopathy in extreme cases .

  • What techniques are used to study the translation and assembly of PetB in vivo?

    Several specialized techniques are employed to study PetB translation and assembly in vivo:

    • Pulse-chase labeling: Plants are exposed to radioactive amino acids for a short period (pulse) followed by non-radioactive amino acids (chase). Proteins are then immunoprecipitated using PetB-specific antibodies to track synthesis and turnover rates .

    • Polysome loading analysis: To assess translation efficiency, researchers analyze the association of mRNAs with ribosomes using sucrose gradient fractionation followed by RNA gel blot analysis .

    • Ribosome profiling (Ribo-seq): This technique uses deep sequencing to map mRNA fragments protected by ribosomes, providing a genome-wide, quantitative readout of mRNA sequences bound by ribosomes in vivo. In BSF mutants, this revealed defects in petD translation .

    • BN-PAGE followed by Western blotting: This approach allows visualization of intact protein complexes and subcomplexes to track assembly intermediates .

    • Protein stability assays: Treatment with translation inhibitors (e.g., lincomycin) followed by time-course sampling to assess protein degradation rates .

  • How does the regulation of petB gene expression differ in C3 and C4 photosynthetic pathways in Zea mays?

    The regulation of petB expression shows significant differences between C3 and C4 photosynthetic pathways:

    ParameterC3 PlantsC4 Plants (Zea mays)
    Cell-type specificityUniform expression in mesophyll cellsDifferential expression between mesophyll and bundle sheath cells
    PetB protein abundanceHigher in mesophyll cells relative to total proteinCell-type specific distribution: lower in bundle sheath compared to mesophyll cells
    Complex stoichiometryConsistent across leaf tissueVariable between cell types, reflecting metabolic specialization
    Regulatory factorsGeneral photosynthetic regulatorsAdditional cell-type specific regulation

    In C4 plants like maize, bundle sheath cells typically have reduced levels of Cyt b6f complex and PSII compared to mesophyll cells, reflecting their metabolic specialization . This differential distribution is evident in immunoblot analyses of thylakoid fractions from these cell types. The regulatory mechanisms controlling this differential expression involve both transcriptional and post-transcriptional processes that are coordinated with the development of Kranz anatomy in C4 plants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.