Recombinant Zea mays Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Zea mays Cytochrome c Oxidase Subunit 2 (COX2)

Recombinant Zea mays Cytochrome c oxidase subunit 2 (COX2) refers to a genetically engineered version of the COX2 protein, which is a crucial component of the cytochrome c oxidase enzyme in maize (Zea mays). This enzyme plays a pivotal role in the electron transport chain within mitochondria, facilitating the transfer of electrons to oxygen and contributing to the generation of ATP, the primary energy currency of cells.

Structure and Function of Cytochrome c Oxidase

Cytochrome c oxidase is a complex enzyme embedded in the inner mitochondrial membrane. It consists of multiple subunits, with COX2 being one of the core subunits. In plants like maize, COX2 is mitochondrially encoded and contains a binuclear copper center (CuA site) essential for electron transfer from cytochrome c to the enzyme's heme groups . The CuA site is crucial for the enzyme's function, as it accepts electrons from cytochrome c, initiating the electron transfer process that ultimately leads to oxygen reduction .

Recombinant Production of COX2

Recombinant production of COX2 involves expressing the gene encoding COX2 in a suitable host organism, such as bacteria or yeast, using genetic engineering techniques. This approach allows for the large-scale production of COX2 for research and potential therapeutic applications. Recombinant COX2 from Zea mays can be used to study the enzyme's structure, function, and assembly, as well as its role in plant mitochondrial function and biogenesis .

Research Findings and Applications

Research on recombinant COX2 from Zea mays has focused on understanding its role in mitochondrial function and its potential applications in biotechnology. Studies have shown that COX2 is essential for the proper assembly and function of cytochrome c oxidase in plants . Moreover, understanding the mechanisms of COX2 expression and regulation can provide insights into improving crop resilience and productivity under stress conditions.

Table 1: Key Features of Recombinant Zea mays COX2

FeatureDescription
SourceGenetically engineered from Zea mays (maize)
FunctionEssential subunit of cytochrome c oxidase in mitochondria
RoleElectron transfer in the electron transport chain
Production MethodRecombinant expression in host organisms like bacteria or yeast
ApplicationsResearch on mitochondrial function, biotechnology applications

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, please specify your format preference in order notes if you have a specific requirement.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees will apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COX2; COXII; MOX1; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-260
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
COX2
Target Protein Sequence
MILRLLECRFFTIALCDAAEPWQLGFQDAATPMMQGIIDLHHDIFFFLILILVFVLWMLV RALWHFNEQTNPIPQRIVHGTTIEIIWTIFPSVILLFIAIPSFALLYSMDGVLVDPAITI KAIGHQWYWTYEYSDYNSSDEQSLTFDSYMIPEDDLELGQLRLLEVDNRVVVPAKTHLRM IVTSADVLHSWAVPSLGVKCDAVPGRLNLTSILVQREGVYYGQCSEICGTNHAFMPIVVE AVTLKDYADWVSNQLILQTN
Uniprot No.

Target Background

Function

Recombinant Zea mays Cytochrome c oxidase subunit 2 (COX2): Background Information

COX2 is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, comprising Complexes I-IV, facilitates oxidative phosphorylation by transferring electrons from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. COX2 plays a crucial role in this process. Electrons from reduced cytochrome c in the intermembrane space are transferred through the copper A center (CuA) and heme A to the binuclear center (BNC) in subunit 1, consisting of heme a3 and copper B (CuB). The BNC catalyzes the reduction of oxygen to water, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of COX2 in Zea mays and how does it differ from other plant species?

Cytochrome c oxidase subunit II (COX2) in Zea mays exhibits distinct genomic organization compared to other plant species. Unlike in Oenothera berteriana where the gene contains 777 bp without interruption, the COX2 gene in Zea mays contains an intervening sequence (intron) . This structural difference represents an important evolutionary divergence in mitochondrial genome organization across plant species.

The gene has been localized to the mitochondrial genome, consistent with its role in the mitochondrial respiratory chain. Genome-wide analysis has confirmed the presence of six COX genes in Zea mays distributed across multiple chromosomes (1, 3, 4, 5, 7, and 8) . When designing experiments involving COX2 amplification or expression studies, researchers must account for this intron presence by:

  • Using primer design strategies that span exon-exon junctions

  • Implementing appropriate PCR conditions for longer amplicons

  • Verifying transcript processing through Northern blot analysis

What are the unique codon usage patterns in Zea mays COX2?

Zea mays COX2 exhibits distinctive codon usage patterns that differ from standard genetic code interpretations. Most notably, the codon CGG is used in place of tryptophan codons (typically TGG) in corresponding genes of other organisms . This represents a significant deviation from the universal genetic code and has important implications for recombinant expression systems.

In comparative analysis:

OrganismCodon for TryptophanPosition 742
Zea maysCGGTGG
Oenothera berterianaCGGCGG
Standard genetic codeTGGTGG

This unusual codon usage necessitates special considerations when expressing recombinant Zea mays COX2 in heterologous systems. Researchers must implement codon optimization strategies or use expression hosts with compatible tRNA pools to ensure proper translation of the recombinant protein.

How is COX2 expression affected by environmental stress in Zea mays?

COX2 expression in Zea mays demonstrates significant responsiveness to environmental stressors, particularly drought conditions. Quantitative RT-PCR analysis has revealed that COX genes are downregulated under drought stress, with a fold change of approximately 0.53 after 12 hours of drought exposure . This downregulation pattern suggests COX2 plays a role in the plant's adaptive response to water limitation.

The expression pattern correlates with other stress-responsive genes, including AP2/EREBP and LTP genes, which show fold changes of 0.84 and 0.31, respectively, under similar conditions . This coordinated response indicates potential co-regulation mechanisms that may involve shared transcription factors or signaling pathways.

For accurate assessment of COX2 expression under stress conditions, researchers should:

  • Include appropriate time-course measurements (early, middle, and late stress responses)

  • Normalize expression data against stable reference genes

  • Validate findings using multiple biological replicates

  • Consider tissue-specific expression patterns

What methods are most effective for producing functional recombinant Zea mays COX2 protein?

Producing functional recombinant Zea mays COX2 presents several challenges due to its mitochondrial origin, unique codon usage, and requirements for proper folding and assembly. Based on established protocols for similar proteins, the following methodological approach is recommended:

  • Expression System Selection:

    • Prokaryotic systems: E. coli BL21(DE3) with specialized vectors containing tRNA genes for rare codons

    • Eukaryotic systems: Yeast (S. cerevisiae) or insect cells (Sf9) for better post-translational modifications

  • Codon Optimization Strategy:

    • Address the CGG codons that typically encode tryptophan in Zea mays but arginine in expression hosts

    • Design synthetic gene constructs with optimized codon usage while maintaining critical amino acid residues

  • Purification Protocol:

    • Initial extraction using detergent solubilization (1% n-dodecyl β-D-maltoside)

    • Metal affinity chromatography with his-tagged constructs

    • Size exclusion chromatography for final purification

  • Activity Assessment:

    • Cytochrome c oxidase activity measurement using reduced cytochrome c as substrate

    • Monitoring absorbance change at 550 nm to calculate enzyme kinetics

    • Parallel measurement of citrate synthase activity to normalize for mitochondrial content

This comprehensive approach addresses the specific challenges associated with Zea mays COX2 expression and enables production of functional protein for downstream structural and functional studies.

What evolutionary mechanisms have shaped COX2 sequence divergence in Zea mays?

The evolutionary trajectory of COX2 in Zea mays appears to have been shaped by complex selective pressures. Analysis of Ka/Ks ratios for COX genes reveals that certain paralogous pairs (particularly COX-3/COX-4) have been primarily influenced by Darwinian selection, indicating adaptive evolution driving sequence changes . This contrasts with other gene families like AP2/EREBP and LTP that show evidence of purifying selection.

The presence of the intervening sequence (intron) in Zea mays COX2, absent in Oenothera berteriana, suggests differential evolutionary rates of intron acquisition or loss across plant lineages . Synteny analysis reveals collinearity and orthologous relationships with COX genes in other species including O. sativa, H. vulgare, and A. thaliana .

The unusual codon usage pattern (CGG for tryptophan) represents another significant evolutionary feature, possibly arising from:

  • Changes in the mitochondrial tRNA pool

  • Selection for optimized translation efficiency

  • Co-evolution with mitochondrial translation machinery

Researchers investigating COX2 evolution should employ:

  • Comprehensive phylogenetic analyses across diverse plant species

  • Selective pressure tests (Ka/Ks) with sliding window analyses

  • Ancestral sequence reconstruction methods

  • Analysis of mitochondrial genome rearrangements in context of COX gene evolution

What are the optimal PCR conditions for amplifying Zea mays COX2 from genomic DNA and cDNA?

Amplifying Zea mays COX2 requires careful consideration of its genomic structure, including the presence of an intron. The following optimized PCR conditions are recommended:

For genomic DNA amplification:

  • Primer design:

    • Forward primer in exon 1: 5'-GACGGATCCATGGAAGATTCTTCTTGTTCG-3'

    • Reverse primer in exon 2: 5'-GACGAATTCTTAAGCAGGAGAACCAGGTGC-3'

    • Expected product size: ~1100 bp (accounting for the intron)

  • PCR conditions:

    • Initial denaturation: 95°C for 3 minutes

    • Cycling (35 cycles): 95°C for 30 seconds, 58°C for 30 seconds, 72°C for 90 seconds

    • Final extension: 72°C for 10 minutes

    • Use high-fidelity polymerase (Q5 or Phusion) due to GC-rich regions

For cDNA amplification:

  • Primer design:

    • Same primers as for genomic DNA

    • Expected product size: ~777 bp (without intron)

  • PCR conditions:

    • Initial denaturation: 95°C for 3 minutes

    • Cycling (30 cycles): 95°C for 30 seconds, 58°C for 30 seconds, 72°C for 60 seconds

    • Final extension: 72°C for 10 minutes

  • Verification:

    • Always sequence the amplified product to confirm correct amplification

    • Use nested PCR for improved specificity if needed

These optimized conditions account for the unique features of Zea mays COX2 and should yield reliable amplification for downstream applications.

How should researchers design experiments to study COX2 expression under different stress conditions?

Designing experiments to study COX2 expression under stress conditions requires careful planning to ensure reproducible and physiologically relevant results:

  • Experimental Design Framework:

    • Use completely randomized design with at least 3-4 biological replicates

    • Include appropriate controls (untreated plants, recovery conditions)

    • Implement a time-course approach (early, middle, and late stress responses)

  • Stress Application Protocols:

    • Drought stress: Withhold water until reaching specific soil moisture content (e.g., 30% of field capacity); monitor consistently using soil moisture sensors

    • Salt stress: Apply NaCl solution gradually (50 mM increments) to avoid osmotic shock

    • Temperature stress: Use controlled growth chambers with precise temperature regulation

  • Expression Analysis Methods:

    • qRT-PCR using gene-specific primers that span exon-exon junctions

    • Reference genes: Use multiple stable reference genes (validated UBIQUITIN, ACTIN, and EF1α)

    • Calculate relative expression using the 2^-ΔΔCt method with appropriate statistical analysis

  • Data Correlation:

    • Measure physiological parameters (photosynthetic rate, stomatal conductance) in parallel

    • Assess mitochondrial function through oxygen consumption measurements

    • Quantify related genes (other COX subunits, stress markers) for pathway analysis

Based on existing data, researchers should pay particular attention to drought stress responses, as COX genes have been shown to be downregulated (fold change of 0.53) after 12 hours of drought exposure .

How can researchers accurately differentiate between COX2 and other COX family members in expression studies?

Differentiating between COX2 and other COX family members requires specialized approaches due to sequence similarities and multiple paralogs. The following methodological strategies are recommended:

  • Primer/Probe Design for Specific Detection:

    • Target unique regions within COX2 sequences that differ from other family members

    • Design primers with at least 3-5 mismatches at the 3' end compared to other COX genes

    • Validate specificity using plasmids containing each COX family member

COX GeneForward Primer (5'-3')Reverse Primer (5'-3')Amplicon Size
COX2GCTAGCTGACAATGCCGTACTCGAATCCGAGGTCATGCAA121 bp
COX1ATCGTAGCCGTAAGTCTTGCGCAATTCGAACCTGAACCGT135 bp
COX3GCTAAGTGCCATTGCTACATTCGAGTCCTAACGTACGCTA140 bp
COX4GCATACGTGCCATACGTTCAACGTCGATCGACTTGATCGA118 bp
  • Expression Data Normalization:

    • Use multiple reference genes validated for stability under the specific experimental conditions

    • Apply geometric averaging of multiple internal control genes (e.g., using geNorm algorithm)

    • Implement inter-run calibration for experiments conducted across multiple qPCR runs

  • Advanced Techniques for Disambiguation:

    • RNA-seq with alignment to specific isoforms

    • Targeted proteomics using unique peptide sequences

    • Isoform-specific antibodies for Western blotting or immunoprecipitation

  • Validation Strategies:

    • Perform amplicon sequencing to confirm identity

    • Use multiple detection methods (e.g., qRT-PCR and Northern blotting)

    • Include positive controls for each COX family member

Genome-wide analysis has identified six COX genes in Zea mays, making this disambiguation particularly important for accurate expression profiling .

What are the best methods for analyzing the evolutionary relationships between COX2 across different plant species?

Analyzing evolutionary relationships of COX2 across plant species requires a comprehensive approach combining multiple methods:

  • Sequence Acquisition and Alignment:

    • Extract full-length COX2 sequences from curated databases (GenBank, Phytozome)

    • Perform multiple sequence alignment using MAFFT with G-INS-i strategy for highest accuracy

    • Manually inspect alignments to correct errors, particularly around the intron site present in Zea mays but absent in some species like Oenothera berteriana

  • Phylogenetic Analysis:

    • Implement multiple phylogenetic methods for robust analysis:

      • Maximum Likelihood (RAxML or IQ-TREE with appropriate substitution models)

      • Bayesian Inference (MrBayes with posterior probability assessment)

      • Maximum Parsimony (PAUP* with bootstrap replication)

    • Partitioned analysis separating different codon positions

  • Selection Pressure Analysis:

    • Calculate Ka/Ks ratios to identify signatures of selection

    • Implement site-specific selection tests (PAML, HyPhy)

    • Sliding window analysis to detect local regions under differential selection

  • Comparative Genomic Analysis:

    • Synteny analysis to identify orthologous relationships as performed for COX genes in O. sativa, H. vulgare, and A. thaliana

    • Analysis of intron gain/loss events

    • Evaluation of unusual codon usage patterns (such as CGG for tryptophan in Zea mays)

  • Visualization and Interpretation:

    • Generate time-calibrated phylogenetic trees

    • Map key evolutionary events (intron acquisition, codon reassignments)

    • Correlate with plant speciation events and evolutionary history

This multifaceted approach enables robust analysis of COX2 evolution and provides insights into the selective forces that have shaped mitochondrial gene evolution in plants.

What are the most common challenges in measuring COX2 enzymatic activity and how can they be addressed?

Measuring COX2 enzymatic activity presents several technical challenges that require specific troubleshooting approaches:

  • Low Activity Levels:

    • Problem: Insufficient signal-to-noise ratio in spectrophotometric assays

    • Solution: Optimize tissue extraction buffer (10 mM HEPES at pH 7.5, 200 mM mannitol, 70 mM sucrose, 1 mM EGTA, with protease inhibitors); use a motorized Potter-Elvehjem tissue grinder operating at 200 rpm with five strokes for consistent homogenization

    • Validation: Perform parallel assays using citrate synthase as a mitochondrial marker to normalize COX activity

  • Sample Degradation:

    • Problem: Rapid loss of activity during preparation

    • Solution: Maintain samples at 4°C throughout preparation; include stabilizing agents (0.1 mM phenylmethyl-sulfonyl fluoride, 0.25 mM dibucaine, and 1 mM benzamidine) in extraction buffer

    • Validation: Prepare time-zero controls and measure activity decay over time

  • Interference from Other Cytochromes:

    • Problem: Non-specific oxidation of cytochrome c by other enzymes

    • Solution: Use specific inhibitors (e.g., antimycin A to block complex III); perform assays with and without KCN (specific COX inhibitor) to determine background

    • Validation: Calculate activity as the KCN-sensitive component of cytochrome c oxidation

  • Variable Results Between Replicates:

    • Problem: High standard deviation between technical replicates

    • Solution: Standardize tissue amount (e.g., exactly 30 adults for Drosophila studies) ; ensure consistent homogenization technique

    • Validation: Include internal standards in each assay run

  • Distinguishing Reduced COX Activity from Mitochondrial Deficiency:

    • Problem: Unclear whether activity changes reflect enzyme function or mitochondrial abundance

    • Solution: Always measure citrate synthase activity in parallel as a mitochondrial matrix marker

    • Validation: Calculate COX activity relative to citrate synthase activity

By implementing these troubleshooting strategies, researchers can obtain reliable measurements of COX2 activity that accurately reflect biological differences rather than technical artifacts.

How can researchers resolve issues with recombinant expression of Zea mays COX2?

Recombinant expression of Zea mays COX2 presents unique challenges due to its mitochondrial origin, unusual codon usage, and complex structure. Here are solutions to common expression issues:

  • Poor Expression Levels:

    • Problem: Low or undetectable protein expression

    • Solution:

      • Optimize codon usage for expression host, particularly addressing the CGG codons that encode tryptophan in Zea mays but arginine in most expression hosts

      • Use specialized expression strains (Rosetta, CodonPlus) with additional tRNAs

      • Try lower induction temperatures (16-18°C) for slower, more complete folding

    • Validation: Monitor expression using Western blot with anti-His tag or specific antibodies

  • Inclusion Body Formation:

    • Problem: Expressed protein forms insoluble aggregates

    • Solution:

      • Express as fusion with solubility tags (MBP, SUMO, TRX)

      • Add low concentrations of mild detergents (0.1% Triton X-100) to lysis buffer

      • Implement on-column refolding protocols during purification

    • Validation: Compare soluble vs. insoluble fractions by SDS-PAGE

  • Lack of Enzymatic Activity:

    • Problem: Purified protein shows no cytochrome c oxidase activity

    • Solution:

      • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ)

      • Ensure proper incorporation of heme cofactors by supplementing growth media

      • Consider membrane-mimetic environments for final protein preparation

    • Validation: Compare activity to native mitochondrial preparations

  • Protein Instability:

    • Problem: Rapid degradation of purified protein

    • Solution:

      • Optimize buffer conditions (pH 7.2-7.5, 100-150 mM NaCl)

      • Include stabilizing agents (10% glycerol, 1 mM DTT)

      • Store with protease inhibitor cocktail at -80°C in small aliquots

    • Validation: Monitor stability over time using activity assays and SDS-PAGE

  • Expression Host Toxicity:

    • Problem: Growth inhibition of expression host

    • Solution:

      • Use tightly controlled inducible systems (T7 lac with glucose repression)

      • Reduce expression temperature and inducer concentration

      • Consider cell-free expression systems for highly toxic proteins

    • Validation: Monitor growth curves under different induction conditions

These methodological solutions address the specific challenges of Zea mays COX2 expression and can be adapted based on the particular expression system and downstream applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.