Recombinant Zea mays Cytochrome c oxidase subunit 3 (COX3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in stock. However, if you have specific requirements for the format, kindly indicate them during order placement, and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery estimates, please consult your local distributors.
Note: All of our proteins are standardly shipped with normal blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
COX3; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
COX3
Target Protein Sequence
MIESQRHSYHLVDPSPWPISGSLGALATTVGGVMYMHSFQGGATLLSLGLIFLLYTMFVW WRDVLRESTLEGHHTKAVQLGPRYGSILFIVSEVMSFFLFFWASSHSSLAPTVEIGGIWP PKGIGVLDPWEIPLLNTPILPSSGAAVTWAHHAILAGKEKRAVYALVATVLLALVSTGFQ GMEYYQAPSTISDSIYGSTFLLATGFHGFHVIIGTLFLIVCGIRQYLGHLTKKHHVGFEA AAWYWHFVDVVRLFPFVSIYWWGGT
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COX3) is a component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain responsible for driving oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work together to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner membrane that powers transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules utilizing 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c Oxidase Subunit 3 (COX3) in Zea mays?

Cytochrome c Oxidase Subunit 3 (COX3) is one of the key subunits of the cytochrome c oxidase complex in Zea mays (maize). It forms part of the electron transport chain in mitochondria, playing a crucial role in cellular respiration. In Zea mays, COX3 is one of six identified COX genes discovered through genome-wide analysis. These genes play important roles in the plant's response to various environmental stresses, particularly drought conditions . The protein contains the characteristic Cyt_c_Oxidase_Vb domain, which is essential for its function in the respiratory chain .

How is COX3 genetically characterized in Zea mays?

Genome-wide analysis has identified six COX genes in Zea mays L., including COX3. These genes are distributed across multiple chromosomes, with COX genes found on chromosomes 1, 3, 4, 5, 7, and 8 . COX3 specifically forms an interesting paralogous pair with COX4, and evolutionary analysis indicates that these genes have been under Darwinian selection (driving change), as evidenced by their Ka/Ks ratios . This suggests that COX3 has been actively evolving in response to environmental pressures, distinct from other members of the COX family that might be under purifying selection.

How does Zea mays COX3 relate to COX3 in other organisms?

While Zea mays COX3 shares fundamental functions with COX3 in other organisms as part of the electron transport chain, there are significant species-specific differences. In contrast to mammalian COX3, which has been more extensively studied, plant COX3 operates within a unique cellular environment and regulatory network. For comparison, mammalian COX3 is made from the COX-1 gene but retains intron 1 in its mRNA, creating an insertion in the hydrophobic signal peptide . In mammals, COX3 possesses glycosylation-dependent cyclooxygenase activity and is selectively inhibited by analgesic/antipyretic drugs . The plant COX3 in maize likely has evolved different regulatory mechanisms and structural features adapted to plant-specific metabolic needs and environmental responses.

How is COX3 expression affected by environmental stresses in Zea mays?

Research indicates that COX genes in Zea mays, including COX3, are significantly downregulated under drought stress conditions. Quantitative real-time PCR (qRT-PCR) results have shown that after 12 hours of drought stress, COX expression decreased with a fold change of 0.53 . This downregulation suggests that COX3 plays a role in the plant's adaptive response to water limitation.

The expression pattern in response to stress can be visualized in the following data representation:

Gene FamilyFold Change After 12h Drought StressRegulation Direction
AP2/EREBP0.84Downregulated
COX0.53Downregulated
LTP0.31Downregulated

This suggests that understanding COX3 regulation could be key to developing drought-resistant maize varieties through genetic engineering approaches.

What transcriptional networks regulate COX3 in Zea mays?

While specific transcription factors regulating COX3 in Zea mays are not fully characterized in the provided research, the data suggests potential co-regulation with other stress-responsive gene families. Since AP2/EREBP (APETALA2/ethylene-responsive element-binding protein) genes are downregulated alongside COX genes during drought stress , there may be shared regulatory elements or transcription factor binding sites in their promoter regions. The AP2/EREBP transcription factors are known to be involved in various stress responses in plants, suggesting possible regulatory interactions with COX gene expression through ethylene-responsive elements or dehydration-responsive elements.

How can researchers effectively monitor COX3 expression in maize studies?

For reliable quantification of COX3 expression in maize, researchers should consider the following methodological approach:

  • Tissue selection: Based on the available data, selecting appropriate tissues is crucial as expression patterns may vary across plant organs.

  • Stress treatment protocol: When studying stress responses, implement a standardized drought stress protocol with controlled soil moisture content and environmental conditions.

  • RNA extraction optimization: Use specialized protocols for maize tissues that account for high polysaccharide and phenolic compound content.

  • qRT-PCR design:

    • Select stable reference genes for maize under the specific experimental conditions

    • Design primers specific to COX3 that avoid cross-amplification with other COX family members

    • Include multiple biological and technical replicates

    • Use appropriate statistical methods for data normalization and analysis

  • Consider complementary approaches: RNA-seq can provide a broader view of expression patterns and potential co-regulation networks involving COX3.

What protein domains characterize Zea mays COX3?

Domain analysis has confirmed the presence of the Cyt_c_Oxidase_Vb domain in Zea mays COX proteins . This domain is fundamental to the protein's function in electron transport and oxygen reduction. The domain architecture of COX3 defines its functional capabilities within the cytochrome c oxidase complex.

For comprehensive structural analysis, researchers should consider:

  • Primary sequence analysis to identify conserved residues

  • Secondary structure prediction to map transmembrane regions

  • Homology modeling based on structurally characterized COX3 proteins

  • Analysis of potential post-translational modification sites

What experimental approaches are effective for structural studies of recombinant Zea mays COX3?

When conducting structural studies on recombinant Zea mays COX3, researchers should consider these methodological approaches:

  • Expression system selection: For membrane proteins like COX3, specialized expression systems may be necessary. Insect cell expression systems have been successful for expression of other COX proteins, such as mammalian COX3 .

  • Protein purification strategy:

    • Detergent screening to identify optimal solubilization conditions

    • Affinity chromatography utilizing appropriate tags (His, FLAG, etc.)

    • Size exclusion chromatography for final purification

  • Structural analysis techniques:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy (increasingly valuable for membrane protein complexes)

    • NMR spectroscopy for dynamic studies

    • Circular dichroism to assess secondary structure content

  • Complex assembly analysis:

    • Blue native PAGE to assess incorporation into cytochrome c oxidase complex

    • Co-immunoprecipitation to identify interaction partners

When working with glycosylated proteins like COX3, researchers should note that N-linked glycosylation appears to be necessary for cyclooxygenase activity, as demonstrated in mammalian COX3 studies .

How does recombinant COX3 compare to native COX3 in functional assays?

When comparing recombinant and native COX3, researchers should evaluate several functional parameters:

  • Enzymatic activity: Protocols to measure electron transport activity should be optimized for both native and recombinant proteins.

  • Post-translational modifications: Assessment of glycosylation patterns is particularly important as they affect function. Tunicamycin treatment experiments with mammalian COX3 have demonstrated that N-linked glycosylation is necessary for COX activity .

  • Complex assembly: The ability to integrate into the cytochrome c oxidase complex should be evaluated, as proper assembly is crucial for function.

  • Membrane localization: Proper targeting to mitochondrial membranes is essential for physiological function.

  • Stability parameters: Thermal stability and resistance to proteolytic degradation provide insights into structural integrity.

A systematic comparison should include control experiments and multiple biological replicates to account for variation in expression and purification outcomes.

What expression systems are optimal for recombinant Zea mays COX3?

Based on studies with other COX proteins, researchers should consider these expression system options for Zea mays COX3:

  • Insect cell expression systems: Baculovirus-infected Sf9 cells have been successfully used for the expression of mammalian COX3 and related proteins . This system provides eukaryotic post-translational modifications like glycosylation that appear critical for COX3 function.

  • Plant-based expression systems: For a more native environment, consider:

    • Transient expression in Nicotiana benthamiana

    • Stable transformation of Arabidopsis or rice cell cultures

    • Maize protoplast expression systems for rapid screening

  • Bacterial systems with modifications:

    • E. coli strains engineered for membrane protein expression

    • Fusion partners to enhance solubility and prevent aggregation

When expressing COX3, it's important to note that the signal peptide may not be cleaved during processing, as observed in mammalian COX3 studies , which might affect localization and function of the recombinant protein.

What purification strategies yield highest purity recombinant Zea mays COX3?

For optimal purification of recombinant Zea mays COX3, a multi-step approach is recommended:

  • Initial preparation:

    • Careful cell lysis to preserve membrane integrity

    • Differential centrifugation to isolate membrane fractions

    • Detergent screening to identify optimal solubilization conditions

  • Chromatography sequence:

    • Affinity chromatography using epitope tags (His, FLAG, etc.)

    • Ion exchange chromatography to separate based on charge properties

    • Size exclusion chromatography for final polishing and buffer exchange

  • Quality control assessment:

    • SDS-PAGE and Western blotting to confirm identity and purity

    • Mass spectrometry to verify protein integrity and modifications

    • Activity assays to confirm functional status

For Western blot analysis, researchers can use antibodies specific to conserved amino acid sequences predicted to be encoded by COX3, similar to approaches used for mammalian COX proteins . A combination of epitope tag-specific antibodies and COX3-specific antibodies provides the most robust detection strategy.

How can researchers effectively design activity assays for recombinant Zea mays COX3?

When designing activity assays for recombinant Zea mays COX3, consider these methodological approaches:

  • Electron transport activity:

    • Oxygen consumption measurements using oxygen electrodes

    • Spectrophotometric assays tracking cytochrome c oxidation

    • Polarographic techniques to measure electron transfer rates

  • Complex assembly assessment:

    • Blue native PAGE to visualize intact cytochrome c oxidase complex

    • Co-immunoprecipitation to identify interaction partners

    • Sucrose gradient ultracentrifugation to isolate assembled complexes

  • Controls and validations:

    • Include both positive controls (native mitochondrial preparations) and negative controls

    • Test activity in the presence of known inhibitors of cytochrome c oxidase

    • Verify the effects of blocking glycosylation on activity, as this modification has been shown to be essential for COX3 function in other systems

For comprehensive characterization, combine multiple assay approaches to build a complete functional profile of the recombinant protein.

How has evolutionary selection shaped COX3 in Zea mays?

Evolutionary analysis of COX genes in Zea mays has revealed interesting patterns of selection. While many genes in the COX family appear to be under purifying selection, the Ka/Ks ratios specifically for the COX-3/COX-4 paralogous pairs indicate that these genes have been primarily influenced by Darwinian selection (driving change) . This suggests that these particular COX genes have been actively evolving in response to environmental pressures.

This pattern of selection differs from other gene families analyzed in the same study. For instance, most AP2/EREBP genes and several LTP genes were found to be under purifying selection, indicating strong environmental pressure to maintain their original function . The contrast in evolutionary patterns suggests that COX3 may have evolved new or specialized functions in maize compared to its ancestral role.

Synteny analysis of COX genes, including COX3, has revealed collinearity and orthologous relationships with COX genes in Oryza sativa, Hordeum vulgare, and Arabidopsis thaliana , providing insights into the conservation and divergence of these genes across different plant species.

What role might COX3 play in maize drought response pathways?

The significant downregulation of COX genes (fold change of 0.53) after 12 hours of drought stress suggests that COX3 plays an important role in maize's response to water limitation. This response occurs alongside the downregulation of other stress-responsive gene families like AP2/EREBP and LTP.

The coordinated response suggests COX3 may be involved in:

Researchers investigating drought responses should consider analyzing COX3 within the broader context of mitochondrial function and bioenergetics during stress, as changes in respiratory metabolism are critical aspects of plant stress adaptation.

How can CRISPR-Cas9 be used to study COX3 function in Zea mays?

CRISPR-Cas9 technology offers powerful approaches for investigating COX3 function in maize:

  • Experimental design strategies:

    • Complete gene knockout: Creating null mutations to assess essential functions

    • Domain-specific edits: Targeted modifications to specific functional regions

    • Promoter editing: Altering expression patterns to study regulation

    • Tag insertion: Adding epitope tags for protein localization and interaction studies

  • Guide RNA design considerations:

    • Target uniqueness to avoid off-target effects on other COX family members

    • Selection of PAM sites in conserved regions

    • Screening multiple guide RNAs for efficiency

    • Using paired nickases for increased specificity

  • Delivery methods for maize:

    • Agrobacterium-mediated transformation of immature embryos

    • Biolistic delivery to callus tissue

    • Protoplast transformation for preliminary screening

  • Phenotypic analysis:

    • High-throughput field phenotyping using autonomous robotic platforms as described for maize research

    • Stress response assays, particularly under drought conditions

    • Mitochondrial function assessment

    • Metabolomic profiling to detect shifts in respiratory pathways

  • Validation approaches:

    • Complementation studies with wild-type or modified COX3

    • RNA-seq to identify downstream effects on gene expression

    • Protein interaction studies to map functional networks

When designing CRISPR experiments, researchers should consider the potential lethality of complete COX3 knockout and may want to design conditional systems or partial functional modifications as alternatives.

How can researchers overcome low expression of recombinant Zea mays COX3?

When facing challenges with low expression of recombinant Zea mays COX3, consider these methodological solutions:

  • Expression system optimization:

    • Test multiple expression systems (as noted in section 4.1)

    • Optimize codon usage for the selected expression system

    • Use stronger promoters or inducible expression systems

    • Consider fusion partners that enhance expression and stability

  • Post-translational processing:

    • Ensure proper conditions for glycosylation, as this is critical for COX activity

    • Monitor protein trafficking and membrane insertion

    • Consider co-expression with chaperones or assembly factors

  • Expression conditions optimization:

    • Test different induction times and temperatures

    • Optimize media composition and growth conditions

    • Consider specialized media supplements for membrane protein expression

  • Expression construct design:

    • Include appropriate signal sequences for membrane targeting

    • Consider the inclusion or exclusion of plant-specific transit peptides

    • Test multiple affinity tags to identify optimal positioning

  • Protein extraction and detection:

    • Optimize membrane protein solubilization buffers

    • Test different detergents for extraction efficiency

    • Use sensitive detection methods like fluorescent Western blotting

For membrane proteins like COX3, expression levels often improve when expression conditions are shifted to favor slower protein synthesis (lower temperature, milder induction), allowing proper membrane insertion and folding.

How can researchers address challenges in assembling functional cytochrome c oxidase complexes with recombinant COX3?

Assembly of functional cytochrome c oxidase complexes containing recombinant COX3 presents several challenges:

  • Co-expression strategies:

    • Consider co-expressing multiple subunits of the complex

    • Include known assembly factors specific to COX3 module assembly

    • Studies in human systems have shown that factors like HIGD2A are required for assembly of the COX3 module

  • Assembly assessment methods:

    • Blue native PAGE to visualize complex formation

    • Activity assays to confirm functional assembly

    • Co-immunoprecipitation to verify subunit interactions

    • Mass spectrometry to identify complex components

  • Troubleshooting approaches:

    • If assembly fails, test progressive co-expression of additional components

    • Verify post-translational modifications necessary for assembly

    • Test different detergents for complex stabilization during purification

    • Consider native lipid supplementation to maintain complex integrity

  • Specialized techniques:

    • Synchronous Precursor Selection (SPS)–MS3 based TMT methods can be used to analyze protein complexes, as demonstrated in studies of COX assembly factors

    • Implement quantitative proteomics to track assembly intermediate formation

Understanding the assembly pathway for the cytochrome c oxidase complex in maize will likely require detailed analysis of sequential assembly steps and identification of plant-specific assembly factors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.