Recombinant Zea mays Cytochrome P450 71C1 (CYP71C1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CYP71C1; BX4; 3-hydroxyindolin-2-one monooxygenase; Cytochrome P450 71C1; Protein benzoxazineless 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-535
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
CYP71C1
Target Protein Sequence
MALEAGYDYLHVAVVQCTPTQAAAVLGVLLLLAIRLAAAARSSSATSPKWKQHRLPPTPP GKLPIIGHLHLIGSHPHVSFRDLHAKYGHNGLMLVQVGAVPTIVVSTPQAAEAVLRTHDH VLASRPRNPVADIIRYNSTDVAFAPYGVYWRTARKVVNTHLLSAKMVFSKRREREEEVRL VVARIRDAAEASPGTALDMTELLGGYASDFVCRAVLGESHRKQGRNKLFRELTETSAALL GGFNVEDYFPKLADVDLFLRIICAKAKSVSKRWDSLFNELLSEYALSGGKQGDHNSEDFV HLLLSLQKDYGLTTDNIKGILVNMFEAAIETSFLVLEYSMSELMNNRHVLAKLQKEVRTA TPDGRMVMEEDLSRMPYLKATIKESMRIHPPAPFLLPHFSTHDCEINGYTIPAGTRVIVN AWALARDPTCWDKAEEFFPERFLEQGRDAEVDMYGKDIRFVPFGAGRRICAGATFAIATV EIMLANLIYHFDWEMPAEMERTGAKVDMSDQFGMTLRRTQKLYLVPRIPKCVSSS
Uniprot No.

Target Background

Function
Catalyzes the conversion of 3-hydroxyindolin-2-one to 2-hydroxy-1,4-benzoxazin-3-one (HBOA).
Database Links
Protein Families
Cytochrome P450 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is CYP71C1 and what is its functional role in maize biosynthetic pathways?

CYP71C1 (Cytochrome P450 71C1) is a critical enzyme in maize defense metabolism, specifically functioning as the third P450 hydroxylase in the DIMBOA (2,4-dihydroxy-7-methoxy-1,4-benzoxazin-3-one) biosynthetic pathway . Also known as Protein benzoxazineless 4 (BX4), this enzyme belongs to the cytochrome P450 superfamily characterized by heme-binding domains with the conserved F-G-R-C-G signature motif . DIMBOA compounds serve as important antimicrobial and insecticidal agents in maize, providing natural chemical defense against pests and pathogens. CYP71C1's catalytic activity introduces specific hydroxyl groups essential for the bioactivity of these protective compounds.

The enzyme functions within a multi-step biosynthetic pathway where its activity is precisely coordinated with other P450 enzymes (including others in the CYP71C subfamily) to progressively modify pathway intermediates . The sequential hydroxylation reactions performed by these enzymes contribute to the final production of benzoxazinoid defensive compounds.

How is CYP71C1 gene expression regulated in response to biotic and abiotic stressors?

CYP71C1 exhibits highly regulated expression patterns responsive to both biotic and abiotic stress factors. Transcript levels show distinct induction patterns following exposure to:

  • Chemical inducers: Research demonstrates that CYP71C1 transcripts are induced in response to safener compounds like naphthalic anhydride (NA) and triasulfuron (T), though with different magnitudes depending on plant developmental stage .

  • Mechanical damage: Wounding induces CYP71C1 transcript accumulation approximately 1.3-fold in both 2.5-day-old and 6.5-day-old seedling shoots .

  • Pathogen exposure: Bacterial pathogens like Erwinia stuartii and Acidovorax avenae can trigger CYP71C1 expression as part of the plant's defense response .

This regulation appears to be tissue-specific and developmentally controlled, with expression patterns that differ from other P450s, even those within the same biosynthetic pathway. This suggests sophisticated regulatory mechanisms that fine-tune defensive compound production according to specific stress scenarios and developmental requirements.

What methodological approaches are most effective for analyzing CYP71C1 expression patterns?

For comprehensive analysis of CYP71C1 expression patterns, researchers should employ a multi-technique approach:

  • Quantitative RT-PCR: The most sensitive method for quantifying transcript abundance across different tissues and experimental conditions. Design gene-specific primers targeting unique regions of CYP71C1 to avoid cross-amplification with closely related P450s. For maximum specificity, primers should target regions with minimal sequence identity to other CYP71C family members.

  • Northern blot analysis: Although less sensitive than qRT-PCR, this technique effectively demonstrates relative transcript abundance under different conditions. Previous research successfully employed poly(A)+ mRNA hybridization with specific CYP71C1 cDNA probes under high-stringency conditions, preventing cross-hybridization with related sequences . Important methodological considerations include:

    • Using a constitutive transcript (e.g., maize 1055 cDNA) as normalization control

    • Employing phosphorimager quantification for precise comparative analysis

    • Standardizing RNA extraction methods to minimize technical variability

  • Promoter-reporter fusions: Transgenic approaches using CYP71C1 promoter regions fused to reporter genes (GUS, GFP) can reveal tissue-specific and developmental expression patterns with subcellular resolution.

  • RNA-Seq: For unbiased transcriptome-wide analysis that can identify co-regulated genes and novel regulatory relationships.

When selecting methodology, consider that CYP71C1 displays distinct developmental, tissue-specific, and chemical-dependent expression patterns, even compared to other P450s within the same biosynthetic pathway . This necessitates careful experimental design with appropriate controls and normalization strategies.

How do induction patterns of CYP71C1 compare with other P450s in the DIMBOA pathway?

Comparative analysis reveals distinctive induction patterns among P450s in the DIMBOA pathway, highlighting the complex regulation of this defense system. The table below summarizes relative transcript induction in response to various treatments:

P450 EnzymeNA Treatment (2.5d)NA/T Treatment (2.5d)NA Treatment (6.5d)NA/T Treatment (6.5d)Wounding InductionPB Treatment
CYP71C11.8-fold1.5-fold1.9-fold2.2-fold1.3-foldNo effect
CYP71C32.1-fold1.3-fold2.8-fold3.5-fold1.3-foldNo effect
CYP92A1Not detectedNot detectedNot detected3.0-foldNot studiedInduced
CYP72A5Not detectedNot detectedNot detected4.5-foldNot studiedHighly induced
CYP73A7No significant changeNo significant changeNo significant changeNo significant change1.6-2.1-foldNo effect

Methodological considerations for comparative induction studies:

  • Standardize tissue sampling: CYP71C1 and related P450s show tissue-specific expression patterns, requiring precise separation of shoot and root tissues.

  • Consider developmental stage: Research demonstrates that CYP71C1 and CYP71C3 respond differently to inducers depending on seedling age (2.5 vs. 6.5 days) .

  • Use appropriate controls: Employ constitutively expressed genes (e.g., maize 1055) to normalize expression data across samples.

  • Validate with multiple techniques: Confirm Northern blot results with qRT-PCR to accurately quantify smaller expression changes.

Despite being part of the same pathway, CYP71C1 and CYP71C3 show distinct responses to chemical inducers and developmental cues, suggesting sophisticated regulatory mechanisms that fine-tune defensive metabolite production according to specific environmental conditions .

What are the most effective protocols for heterologous expression and purification of recombinant CYP71C1?

Successful heterologous expression and purification of functional recombinant CYP71C1 requires specialized approaches to accommodate the membrane-associated nature and complex structural requirements of cytochrome P450 enzymes:

  • Expression system selection:

    • Bacterial systems (E. coli): Modify the N-terminal membrane-binding domain by truncation or replacement with bacterial signal sequences. Co-express with molecular chaperones and supplement growth media with δ-aminolevulinic acid (ALA) as heme precursor.

    • Yeast systems (S. cerevisiae, P. pastoris): Often preferred for plant P450s due to presence of endoplasmic reticulum and post-translational modification capability. Integration of expression cassettes into the genome provides stable expression.

    • Insect cell/baculovirus systems: Closest to plant cellular environment among heterologous systems, but more resource-intensive.

  • Optimization strategies:

    • N-terminal modification: Replace the native membrane-anchor with hydrophilic sequences while preserving protein folding.

    • Codon optimization: Adjust codon usage for the expression host to enhance translation efficiency.

    • Temperature modulation: Lower expression temperatures (16-20°C) often improve proper folding.

    • Expression tags: C-terminal His-tag facilitates purification while minimizing interference with N-terminal membrane association.

  • Purification approach:

    • Membrane isolation: Differential centrifugation to isolate microsomal fractions containing CYP71C1.

    • Detergent solubilization: Carefully select detergents (CHAPS, DDM, or Triton X-100) to maintain enzyme activity.

    • Chromatography: Nickel affinity chromatography for His-tagged constructs, followed by size exclusion chromatography to remove aggregates.

  • Activity verification:

    • Carbon monoxide difference spectroscopy: Verify proper heme incorporation by measuring the characteristic 450 nm absorption peak.

    • Substrate binding assays: Monitor spectral shifts upon substrate addition.

    • Activity assays: HPLC or LC-MS analysis of reaction products from in vitro enzyme assays.

When working with recombinant CYP71C1, researchers should be mindful that the specific amino acid sequence contains 535 residues with multiple domains requiring proper folding and heme incorporation for functionality . The choice of expression system significantly impacts yield and activity of the recombinant enzyme.

What experimental approaches can elucidate the substrate specificity and catalytic mechanism of CYP71C1?

Understanding the substrate specificity and catalytic mechanism of CYP71C1 requires strategic experimental design combining biochemical, structural, and computational approaches:

  • In vitro enzyme assays:

    • Substrate range testing: Screen potential substrates including intermediates in the DIMBOA pathway and structurally related compounds.

    • Kinetic parameter determination: Calculate Km, Vmax, and catalytic efficiency (kcat/Km) for different substrates.

    • Reaction product identification: Employ LC-MS/MS to characterize hydroxylated products, confirming regioselectivity of the enzyme.

    • Inhibition studies: Test competitive and non-competitive inhibitors to probe active site characteristics.

  • Structure-function analysis:

    • Site-directed mutagenesis: Systematically alter residues in substrate recognition sites (SRS) and analyze effects on activity.

    • Chimeric enzymes: Create fusion proteins between CYP71C1 and related P450s with different specificities to identify domains controlling substrate preference.

    • Homology modeling: Generate structural models based on crystallized P450s to predict substrate binding modes.

    • Molecular docking: Computational prediction of substrate-enzyme interactions to guide mutagenesis experiments.

  • Spectroscopic techniques:

    • Binding spectroscopy: Monitor spectral shifts upon substrate binding to determine dissociation constants.

    • Stopped-flow kinetics: Analyze pre-steady-state kinetics to identify rate-limiting steps.

    • EPR spectroscopy: Characterize the electronic environment of the heme iron during catalysis.

  • Isotope labeling studies:

    • Deuterium kinetic isotope effects: Determine if C-H bond breaking is rate-limiting.

    • 18O incorporation: Track oxygen atom incorporation from molecular oxygen versus water.

Research indicates CYP71C1 functions as the third hydroxylase in the DIMBOA biosynthetic pathway , suggesting its primary substrate is likely the product of the preceding enzyme (CYP71C2). The enzyme's substrate specificity is likely influenced by its unique structural features, as it shares only 61-62% sequence identity with other hydroxylases in the same pathway .

How can CRISPR-Cas9 gene editing be optimized for functional analysis of CYP71C1 in planta?

CRISPR-Cas9 gene editing offers powerful approaches for functional analysis of CYP71C1 in maize, requiring careful optimization of several key parameters:

  • Guide RNA (gRNA) design strategies:

    • Target specificity: Design gRNAs specific to CYP71C1 to avoid off-target effects on related P450 genes, particularly other CYP71C family members that share sequence similarity.

    • Functional domain targeting: Design gRNAs targeting catalytic domains versus regulatory regions for different functional outcomes.

    • Efficiency prediction: Utilize maize-specific CRISPR design tools that account for genomic context and chromatin accessibility.

  • Delivery methods for maize transformation:

    • Agrobacterium-mediated transformation: Optimize for specific maize genotypes using immature embryos.

    • Biolistic transformation: Direct delivery of CRISPR-Cas9 components as ribonucleoprotein complexes to minimize transgene integration.

    • Protoplast transformation: For transient expression and validation of gRNA efficiency prior to stable transformation.

  • Editing strategy options:

    • Knockout approach: Complete gene disruption through frameshift mutations or premature stop codons.

    • Base editing: Precise nucleotide substitutions without double-strand breaks to create specific amino acid changes.

    • Prime editing: Targeted insertions or precise sequence replacements for more sophisticated modifications.

    • Promoter editing: Modifying regulatory regions to alter expression patterns rather than protein function.

  • Phenotypic analysis considerations:

    • Metabolite profiling: Quantify DIMBOA and pathway intermediates using LC-MS to assess biosynthetic impacts.

    • Stress response assays: Challenge edited plants with pathogens and pests known to be affected by DIMBOA.

    • Developmental analysis: Monitor potential pleiotropic effects across different tissues and growth stages.

    • Compensatory mechanisms: Assess potential upregulation of related P450s in response to CYP71C1 disruption.

  • Validation approaches:

    • Complementation analysis: Reintroduce wild-type or modified CYP71C1 to confirm phenotype causality.

    • Expression analysis: Quantify transcript levels of CYP71C1 and related genes to assess pathway impacts.

    • Off-target analysis: Sequence potential off-target sites predicted computationally.

When designing CRISPR experiments for CYP71C1, researchers should consider its involvement in the DIMBOA pathway and potential interactions with other pathway components . The gene's inducible expression patterns in response to various stressors suggest that phenotypic analysis should include appropriate stress treatments to fully reveal functional roles.

How does CYP71C1 function compare with other plant cytochrome P450s involved in defense pathways?

Comparative analysis of CYP71C1 with other defense-related P450s reveals both shared mechanisms and unique functional aspects:

  • Functional comparison with related maize P450s:

    • DIMBOA pathway P450s: CYP71C1 functions as the third hydroxylase in this pathway, exhibiting 61-62% sequence identity with the second and fourth hydroxylases (CYP71C2 and CYP71C3v1) but only 47% identity with the first hydroxylase . This suggests functional specialization within a conserved pathway.

    • Zealexin pathway P450s: In contrast to CYP71C1's role in benzoxazinoid biosynthesis, CYP71Z18 functions in zealexin production, catalyzing oxidation of carbon-15 in (S)-β-macrocarpene to form zealexin A1 . Both represent parallel but distinct defense pathways in maize utilizing different P450 subfamilies.

  • Catalytic mechanism conservation:

    • All plant defense P450s share the fundamental heme-dependent monooxygenase mechanism, incorporating one oxygen atom from O₂ into the substrate.

    • Substrate specificity varies dramatically, with CYP71C1 specialized for specific DIMBOA precursors while other defense P450s target diverse substrates including monoterpenes, sesquiterpenes, and phenylpropanoids.

  • Regulatory pattern comparison:

    • CYP71C1 shows distinct induction patterns in response to chemical treatments compared to other P450s, with unique developmental and tissue-specific expression profiles .

    • This contrasts with zealexin-pathway P450s like CYP71Z18, whose transcription patterns closely match sesquiterpene synthases and zealexin accumulation during fungal infection .

  • Evolutionary relationships:

    • CYP71C1 belongs to the plant-specific CYP71 clan, the largest P450 family in plants with diverse roles in specialized metabolism.

    • Sequence comparison suggests that defense-related P450s often evolved through gene duplication and subsequent neofunctionalization, explaining the sequence similarities within the CYP71C subfamily.

Methodologically, comparative functional analysis requires:

  • Phylogenetic analysis of sequence relationships

  • Expression pattern comparison using standardized conditions

  • In vitro enzyme assays with standardized protocols to compare kinetic parameters

  • Metabolomic analysis of knockout/knockdown lines to assess pathway impacts

The unique expression patterns and catalytic properties of CYP71C1 highlight the specialized nature of plant defense systems, where closely related enzymes have evolved distinct regulatory and functional characteristics to optimize responses to different stress conditions .

What methodological challenges exist in distinguishing CYP71C1 activity from other closely related P450s?

Distinguishing the specific activity of CYP71C1 from related P450s presents several significant methodological challenges requiring sophisticated experimental approaches:

  • Sequence similarity challenges:

    • High homology problem: CYP71C1 shares 93% amino acid identity with CYP71C3v1 and 61-62% identity with other DIMBOA pathway hydroxylases , complicating design of specific primers, probes, and antibodies.

    • Solution approaches:

      • Design oligonucleotides targeting unique regions, even if limited to short sequences

      • Use high-stringency hybridization conditions in Northern blots

      • Employ digital PCR for absolute quantification of closely related transcripts

  • Functional redundancy issues:

    • Overlapping substrate specificity: Related P450s may accept the same substrates but with different efficiencies or regioselectivity.

    • Resolution strategies:

      • Detailed kinetic analysis comparing Km, Vmax, and product profiles

      • Analysis of reaction products using high-resolution LC-MS/MS to identify subtle differences in hydroxylation positions

      • Sequential gene silencing/knockout to isolate individual enzyme contributions

  • Specific antibody development challenges:

    • Cross-reactivity issues: Traditional antibody approaches often cannot distinguish between highly similar proteins.

    • Advanced approaches:

      • Generate antibodies against synthetic peptides from unique regions

      • Epitope tagging of recombinant proteins for specific detection

      • Mass spectrometry-based proteomics using unique peptide signatures

  • In planta functional analysis complications:

    • Compensatory mechanisms: Knockout of CYP71C1 may trigger upregulation of related P450s, masking phenotypes.

    • Advanced solutions:

      • Higher-order mutants targeting multiple family members

      • Inducible silencing systems to avoid developmental compensation

      • Tissue-specific gene editing to localize effects

  • Heterologous expression considerations:

    • Proper folding and activity: Closely related P450s may require different expression conditions for optimal activity.

    • Optimization strategies:

      • Systematic testing of expression hosts, temperatures, and membrane environments

      • Co-expression with plant-specific reductase partners

      • Creation of optimized synthetic genes with modifications for expression system

The most effective approach combines multiple complementary methods, including precise enzyme kinetics, high-resolution analytical chemistry, and carefully designed genetic manipulations. Researchers should particularly focus on the distinct expression patterns of CYP71C1 versus other P450s in response to various chemical inducers and developmental cues, which can provide a functional fingerprint even when direct enzyme activity is difficult to distinguish .

How can knowledge of CYP71C1 function contribute to improving crop resistance to pests and pathogens?

Understanding CYP71C1 function offers multiple strategic approaches for enhancing crop protection through both conventional breeding and biotechnological interventions:

  • Precision breeding strategies:

    • Marker-assisted selection: Develop molecular markers linked to functional CYP71C1 alleles with optimal expression patterns and catalytic efficiency.

    • Germplasm screening: Identify natural variants with enhanced CYP71C1 expression or activity in diverse maize landraces and wild relatives.

    • Trait stacking: Combine optimized CYP71C1 alleles with genes affecting other steps in the DIMBOA pathway for additive or synergistic effects.

  • Genetic engineering approaches:

    • Promoter modifications: Engineer CYP71C1 regulatory regions for faster or stronger induction upon pathogen detection.

    • Tissue-specific expression: Target CYP71C1 overexpression to vulnerable tissues using specific promoters.

    • Heterologous expression: Introduce the maize DIMBOA pathway including CYP71C1 into crops lacking this defense mechanism.

  • Agronomic management implications:

    • Chemical priming: Apply safe chemical inducers known to upregulate CYP71C1 expression as preventative treatments before anticipated pest pressure.

    • Developmental timing: Schedule planting to maximize DIMBOA accumulation during vulnerable growth stages based on CYP71C1 expression patterns.

    • Compatible biocontrol: Identify beneficial microorganisms that enhance CYP71C1 expression without triggering full defense responses.

  • Research considerations for implementation:

    • Metabolic balance: CYP71C1 manipulation must avoid disrupting primary metabolism or causing growth penalties.

    • Resistance durability: Monitor potential adaptation by pests to enhanced DIMBOA levels.

    • Non-target effects: Assess impacts on beneficial insects and soil microbiota.

Research shows that CYP71C1 transcript levels are induced in response to chemical treatments and pathogen exposure, with distinct patterns depending on developmental stage and tissue type . These induction patterns provide valuable insights for designing targeted intervention strategies. The enzyme's role in the DIMBOA pathway directly contributes to the production of defensive compounds with documented activity against both insect herbivores and microbial pathogens.

Understanding the specific catalytic properties of CYP71C1 also enables the development of chemicals that specifically enhance or complement the natural defense pathway, potentially offering more environmentally sustainable pest management options compared to conventional pesticides.

What experimental designs can effectively investigate the relationship between CYP71C1 expression and environmental stressors?

To rigorously investigate relationships between CYP71C1 expression and environmental stressors, researchers should implement multi-factorial experimental designs that control for potentially confounding variables:

  • Controlled environment studies:

    • Factorial design: Systematically vary multiple stress factors (temperature, humidity, light intensity, etc.) to identify interaction effects with biotic stressors on CYP71C1 expression.

    • Time-course analysis: Monitor CYP71C1 transcript levels at strategic intervals after stress application to characterize expression kinetics.

    • Tissue-specific sampling: Separately analyze shoots and roots, as CYP71C1 shows tissue-specific expression patterns in response to inducers .

  • Field-based experimental approaches:

    • Split-plot design: Test genotypes with varying CYP71C1 expression levels under different management practices.

    • Multi-location trials: Evaluate CYP71C1 expression patterns across diverse environments to assess G×E interactions.

    • Natural gradient exploitation: Utilize existing environmental gradients to correlate natural variation in stressors with CYP71C1 expression.

  • Molecular phenotyping methodologies:

    • RNA-Seq analysis: Profile global transcriptional responses to identify regulatory networks controlling CYP71C1 expression.

    • ChIP-Seq: Identify transcription factors binding to the CYP71C1 promoter under different stress conditions.

    • Metabolite profiling: Correlate CYP71C1 transcript levels with DIMBOA pathway metabolites using LC-MS/MS.

  • Experimental controls and validation:

    • Genotype controls: Include CYP71C1 mutants/overexpression lines alongside wild-type.

    • Positive controls: Include known inducers like naphthalic anhydride (NA) and triasulfuron (T) .

    • Technical validation: Confirm key findings using multiple expression measurement techniques (qRT-PCR, Northern blotting).

  • Data analysis considerations:

    • Mixed-effects modeling: Account for random effects in field experiments.

    • Principal component analysis: Identify main drivers of CYP71C1 expression variability.

    • Machine learning approaches: Develop predictive models of CYP71C1 expression based on environmental parameters.

Research has demonstrated that CYP71C1 expression responds differently to various inducers depending on developmental stage, with distinct patterns in 2.5-day-old versus 6.5-day-old seedlings . This developmental context must be carefully controlled in experimental designs. Similarly, the observed 1.3-fold induction of CYP71C1 in response to wounding provides a baseline for comparing responses to other stressors .

The most robust experimental designs will integrate molecular, biochemical, and physiological measurements to construct a comprehensive understanding of how CYP71C1 functions within the plant's broader stress response network.

What are the current knowledge gaps and future research priorities regarding CYP71C1 function and regulation?

Despite significant progress in understanding CYP71C1, several critical knowledge gaps remain that should guide future research priorities:

  • Structural biology frontiers:

    • Crystal structure determination: No three-dimensional structure of CYP71C1 has been resolved, limiting understanding of substrate binding mechanisms.

    • Structure-function relationships: Detailed mapping of how specific amino acid residues contribute to substrate recognition and catalytic efficiency.

    • Protein-protein interactions: Identification of potential interactions with electron donor partners and other pathway enzymes.

  • Regulatory mechanism uncertainties:

    • Transcription factor identification: The specific transcription factors binding the CYP71C1 promoter under different conditions remain uncharacterized.

    • Epigenetic regulation: Potential role of DNA methylation, histone modifications, or chromatin remodeling in controlling CYP71C1 expression.

    • Post-translational modifications: Whether protein phosphorylation or other modifications affect CYP71C1 activity or localization.

  • Ecological function questions:

    • Natural variation: Extent of functional allelic diversity in CYP71C1 across maize landraces and how this correlates with local pest pressures.

    • Co-evolutionary relationships: Specific adaptations of pests and pathogens to varying levels of DIMBOA compounds produced via CYP71C1 activity.

    • Microbiome interactions: How CYP71C1-dependent metabolites shape rhizosphere and phyllosphere microbial communities.

  • Applied research priorities:

    • Developing high-throughput screening methods to identify novel CYP71C1 inducers with potential agricultural applications.

    • Creating sensitive biosensors based on CYP71C1 promoter regions to detect specific environmental stressors.

    • Engineering synthetic pathways incorporating CYP71C1 to produce novel bioactive compounds.

  • Methodological advances needed:

    • Development of CYP71C1-specific antibodies that do not cross-react with related P450s.

    • Improved heterologous expression systems that maintain native catalytic properties.

    • Advanced imaging techniques to visualize CYP71C1 localization within plant tissues at high resolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.