Recombinant Zea mays Cytochrome P450 71C2 (CYP71C2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CYP71C2; BX3; indolin-2-one monooxygenase; Cytochrome P450 71C2; Protein benzoxazineless 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-536
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
CYP71C2
Target Protein Sequence
MALGAAYHHYLQLAGDHGTATHALLLGVLIFLVIRLVSARRTGTTSANKRKQQQRLPLPP WPPGKLPIIGHLHLIGAETHISIRDLDAKHGRNGLLLLRIGAVPTLFVSSPSAADAVLRT QDHIFASRPPWMAAEIIRYGPSDVAFVPYGEYGRQGRKLLTTHMLSTKKVQSFRHGRQEE VRLVMDKIRAAATAAPPAAVDLSDLLSGYTNDVVSRAVLGASHRNQGRNRLFSELTEINV SLLAGFNLEDYFPPNMAMADVLLRLVSVKARRLNQRWNDVFDELIQEHVQSRPSGESEES EADFIHVLLSIQQEYGLTTDNLKAILVDMFEAGIETSYLTLEYGMAELINNRHVMEKLQT EVRTTMGSPDGKKLDMLAEEDLGSMPYLKATIKETLRLHPPAPFLLPHYSTADSEIDGYF VPAGTRVLVHAWALGRDRTTWEKPEEFMPERFVQEPGAVDVHMKGKDLRFIPFGSGRRIC PGMNFGFATMEVMLANLMYHFDWEVPGSGAGVSMEESFGLTLRRKEKLLLVPRIAS
Uniprot No.

Target Background

Function

Function: Catalyzes the conversion of indolin-2-one to 3-hydroxyindolin-2-one.

Database Links
Protein Families
Cytochrome P450 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is CYP71C2 and what is its biological function in Zea mays?

CYP71C2 (Cytochrome P450 71C2) is a member of the cytochrome P450 family of enzymes found in maize (Zea mays). It is also known as BX3, indolin-2-one monooxygenase, or Protein benzoxazineless 3. This enzyme plays a crucial role in the biosynthesis of benzoxazinoids, which are secondary metabolites involved in plant defense mechanisms against pests and pathogens. The protein consists of 536 amino acids and functions as a monooxygenase, catalyzing the oxidation of indolin-2-one derivatives in the benzoxazinoid biosynthetic pathway . In herbicide metabolism studies, CYP71C2 has been observed to be down-regulated in certain herbicide-resistant plant populations, suggesting its potential involvement in herbicide sensitivity mechanisms .

What are the optimal conditions for reconstitution and storage of recombinant CYP71C2?

For optimal reconstitution of lyophilized recombinant CYP71C2:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% (range: 5-50%) for long-term stability

  • Aliquot the solution to minimize freeze-thaw cycles

For storage:

  • Short-term (up to one week): Store working aliquots at 4°C

  • Long-term: Store at -20°C/-80°C in glycerol-containing buffer

  • Avoid repeated freeze-thaw cycles as they significantly reduce enzyme activity

  • Use Tris/PBS-based buffer (pH 8.0) containing 6% trehalose for optimal stability

The protein's purity should be greater than 90% as determined by SDS-PAGE for reliable experimental outcomes. Monitoring protein stability through activity assays before each experiment is recommended, particularly when using stored samples.

How can I design enzyme activity assays for recombinant CYP71C2?

Designing robust activity assays for recombinant CYP71C2 requires consideration of several factors:

  • Substrate selection: Use known substrates such as indolin-2-one derivatives or test novel candidates based on structural similarity

  • Reaction conditions:

    • Buffer: 100 mM potassium phosphate (pH 7.4-7.6)

    • Required cofactors: NADPH regenerating system (NADPH, glucose-6-phosphate, glucose-6-phosphate dehydrogenase)

    • Optimal temperature: 25-30°C for maize enzymes

    • Incubation time: Typically 20-60 minutes (determine linearity range)

  • Detection methods:

    • HPLC analysis of substrate depletion/product formation

    • LC-MS for detailed metabolite identification

    • Spectrophotometric monitoring of NADPH consumption (340 nm)

  • Controls:

    • Heat-inactivated enzyme (negative control)

    • Known CYP inhibitors (e.g., piperonyl butoxide) to confirm P450-specific activity

    • Reactions without NADPH to confirm oxidase-dependent activity

When analyzing herbicide metabolism, include appropriate herbicide substrates and monitor formation of specific metabolites through LC-MS/MS methods. For accurate kinetic parameters, use a range of substrate concentrations (0.1-10× Km estimated value) and plot initial velocity versus substrate concentration for Michaelis-Menten analysis .

How does CYP71C2 expression relate to herbicide resistance mechanisms?

Research has shown complex relationships between CYP71C2 expression and herbicide resistance mechanisms. In studies of fenoxaprop-P-ethyl-resistant Beckeropsis syzigachne populations:

  • CYP71C2 was found to be down-regulated in resistant plants compared to susceptible ones, in contrast to other CYP450 family members (such as CYP71D7 and CYP87A3) that were up-regulated

  • This differential regulation pattern suggests that CYP71C2 may play a role in maintaining herbicide sensitivity, and its down-regulation could contribute to resistance mechanisms

  • The expression changes were observed both in untreated plants and those exposed to herbicide treatment, indicating constitutive rather than induced expression patterns

GeneExpression in Resistant vs. Susceptible PlantsPossible Function in Herbicide Response
CYP71C2Down-regulatedMay metabolize herbicides to more active/toxic forms
CYP71D7Up-regulatedMay metabolize herbicides to less toxic forms
CYP87A3Up-regulatedMay metabolize herbicides to less toxic forms

This inverse correlation between CYP71C2 expression and herbicide resistance provides an important research direction for understanding the metabolic basis of non-target-site resistance (NTSR) in plants. Research protocols focusing on CYP71C2 should include expression analysis in both resistant and susceptible plant populations, with and without herbicide treatment .

What structural mutations in CYP71C2 might affect its catalytic function?

While specific mutations in CYP71C2 were not directly reported in the available research, comparative analysis with related cytochrome P450 enzymes suggests potential critical regions:

  • Substrate recognition sites (SRS): Six regions (SRS1-6) typically determine substrate specificity in P450 enzymes. Mutations in these regions could significantly alter substrate binding and catalytic efficiency.

  • Heme-binding domain: Contains a highly conserved sequence that includes a cysteine residue that serves as the fifth ligand for the heme iron. Mutations here would likely abolish enzymatic activity.

  • Oxygen-binding pocket: Mutations affecting oxygen binding and activation would impair the monooxygenase function.

The search results reveal that in related CYP enzymes, single amino acid substitutions can significantly impact function. For example, in CYP87A3, a Leu108→Phe substitution was associated with herbicide resistance . By analogy, similar changes in conserved regions of CYP71C2 might alter its substrate specificity or catalytic efficiency.

For experimental verification of mutation effects, site-directed mutagenesis followed by heterologous expression and activity assays would be the recommended approach, targeting conserved domains and residues identified through sequence alignment with related P450 enzymes.

How does CYP71C2 compare with other members of the CYP71 family in maize?

The CYP71 family in maize includes several members involved in various biosynthetic pathways, with distinct but sometimes overlapping functions:

CYP Family MemberPrimary FunctionRegulation Pattern in Herbicide ResistanceKey Structural Features
CYP71C2 (BX3)Benzoxazinoid biosynthesisDown-regulated in resistant plants536 amino acids, membrane-bound
CYP71C1 (BX2)Indole oxidation in benzoxazinoid pathwayVariableSimilar structural organization to CYP71C2
CYP71C3 (BX4)Later steps in benzoxazinoid pathwayNot reported in search resultsContains conserved P450 motifs
CYP71D7Unknown; possibly involved in herbicide metabolismUp-regulated in resistant plantsShows different substrate specificity from CYP71C2

CYP71C2 functions in conjunction with other enzymes in the benzoxazinoid biosynthetic pathway, catalyzing the conversion of indolin-2-one to 3-hydroxyindolin-2-one. This places it in a metabolic context where its activity affects both plant defense mechanisms and potentially herbicide metabolism.

Experimental approaches to study functional differences should include:

  • Heterologous expression of multiple CYP71 family members

  • Comparative substrate specificity assays

  • Protein structure modeling to identify differences in substrate binding pockets

  • Expression analysis under various stress conditions to determine differential regulation patterns

What are the most effective heterologous expression systems for functional studies of CYP71C2?

Several expression systems can be employed for functional studies of CYP71C2, each with distinct advantages:

  • E. coli expression system:

    • Advantages: Quick growth, high yield, well-established protocols

    • Limitations: Lacks post-translational modifications, membrane protein expression challenges

    • Optimization: Codon optimization, use of special E. coli strains (e.g., Rosetta for rare codons)

    • Currently used for commercial recombinant CYP71C2 production

  • Yeast expression systems (S. cerevisiae, P. pastoris):

    • Advantages: Eukaryotic processing, better folding of complex proteins

    • Applications: Ideal for metabolic pathway reconstitution and substrate specificity studies

    • Methods: Integration of CYP71C2 gene with codon optimization for yeast expression

  • Insect cell systems:

    • Advantages: Superior for membrane proteins, maintains enzyme activity

    • Applications: Complex functional studies requiring native-like enzyme behavior

    • Methods: Baculovirus-mediated expression with optimized signal sequences

Expression system selection should be guided by research objectives:

  • For basic biochemical characterization: E. coli system is sufficient

  • For detailed substrate specificity and kinetic studies: Yeast systems offer better functionality

  • For sophisticated structure-function relationships: Insect cell systems provide more native-like proteins

Co-expression with cytochrome P450 reductase is recommended for functional studies in all systems to ensure proper electron transport to the enzyme.

What are common challenges in purifying active recombinant CYP71C2 and how can they be addressed?

Researchers frequently encounter several challenges when purifying active CYP71C2:

  • Low expression levels:

    • Solution: Optimize codon usage for expression host

    • Use strong inducible promoters (e.g., T7 for E. coli)

    • Lower induction temperature (16-18°C) to improve folding

  • Protein insolubility/aggregation:

    • Solution: Express as fusion protein with solubility tags (e.g., MBP, SUMO)

    • Include detergents during cell lysis (0.5-1% Triton X-100)

    • Add glycerol (10-20%) to stabilize protein structure

  • Loss of heme during purification:

    • Solution: Supplement growth media with δ-aminolevulinic acid (0.5-1 mM)

    • Add hemin (5-10 μM) during protein expression

    • Monitor the 450 nm peak in CO-difference spectrum throughout purification

  • Proteolytic degradation:

    • Solution: Include protease inhibitors in all buffers

    • Minimize purification time

    • Maintain samples at 4°C throughout processing

  • Low specific activity:

    • Solution: Verify proper folding through spectroscopic methods

    • Ensure complete reconstitution from lyophilized form

    • Use storage buffer with 6% trehalose for stability

Recommended purification protocol:

  • Affinity chromatography using Ni-NTA for His-tagged protein

  • Buffer exchange to remove imidazole

  • Size exclusion chromatography to separate aggregates

  • Activity verification after each purification step

How can researchers distinguish between effects of expression level changes and structural mutations when studying CYP71C2 function?

Distinguishing between expression-level effects and structural mutation impacts requires a systematic approach:

  • Quantitative expression analysis:

    • Perform RT-qPCR to quantify mRNA levels in different samples

    • Use western blotting with specific antibodies to quantify protein levels

    • Compare expression patterns across resistant and susceptible plant populations

  • Sequence analysis protocols:

    • Amplify and sequence the complete CYP71C2 coding region from multiple individuals

    • Identify SNPs (Single Nucleotide Polymorphisms) and analyze their distribution

    • Determine if SNPs result in amino acid changes (non-synonymous mutations)

  • Functional validation:

    • Express wild-type and mutant variants at equal levels in heterologous system

    • Compare enzyme kinetics (Km, Vmax, substrate specificity)

    • Perform inhibition studies with specific P450 inhibitors

  • Correlative analysis:

    • Create a table correlating expression levels, mutation status, and observed phenotype

    • Perform statistical analysis to identify significant associations

    • Use multivariate analysis to separate effects of multiple factors

Analysis ApproachExpression-Level ChangesStructural MutationsCombined Effects
MethodRT-qPCR, Western blottingDNA sequencing, SNP analysisHeterologous expression of variants
Expected OutcomeChanges in protein abundanceAltered amino acid sequenceChanges in both abundance and sequence
Control ExperimentNormalize expressionExpress at equal levelsExpress all variants at multiple levels
Statistical AnalysisCorrelation with phenotypeAssociation analysisMultiple regression analysis

In the context of herbicide resistance, researchers should analyze both down-regulation patterns of CYP71C2 and any associated mutations to determine their relative contributions to the resistance phenotype .

What are promising research avenues for understanding CYP71C2's role in crop improvement and herbicide resistance management?

Several promising research directions for CYP71C2 include:

  • CRISPR-Cas9 modification of CYP71C2:

    • Create knockout and overexpression lines in model plants

    • Assess herbicide sensitivity profiles of modified lines

    • Evaluate trade-offs between herbicide metabolism and plant defense

  • Metabolomic profiling:

    • Compare metabolite profiles between plants with different CYP71C2 expression levels

    • Identify novel substrates and products

    • Elucidate the complete metabolic network influenced by CYP71C2

  • Structural biology approaches:

    • Determine crystal structure of CYP71C2

    • Identify substrate binding sites through molecular docking

    • Design selective inhibitors or enhancers based on structural information

  • Field applications:

    • Develop molecular markers for CYP71C2 expression/mutation for early detection of resistance

    • Design herbicide rotation strategies based on CYP71C2 metabolism profiles

    • Create diagnostic tools for resistance management

  • Biotechnological applications:

    • Engineer CYP71C2 variants with modified substrate specificity

    • Develop bioremediation strategies for herbicide-contaminated soils

    • Explore use in biocontrol strategies through enhanced benzoxazinoid production

The down-regulation of CYP71C2 observed in herbicide-resistant plants suggests it may function differently from other P450s involved in herbicide metabolism, possibly converting herbicides to more toxic rather than less toxic forms. This unique mechanism warrants detailed investigation for novel resistance management strategies.

How can high-throughput screening methods be applied to study CYP71C2 interactions with various herbicides and xenobiotics?

High-throughput screening (HTS) methodologies can significantly accelerate research on CYP71C2 interactions:

  • Fluorescence-based activity assays:

    • Use fluorogenic substrates that produce measurable signals upon metabolism

    • Screen in 96/384-well plate format for rapid analysis

    • Quantify inhibition or enhancement by test compounds

  • Mass spectrometry-based screening:

    • Develop MALDI-TOF or LC-MS/MS methods for product detection

    • Use cocktails of potential substrates to increase throughput

    • Employ stable isotope labeling for accurate metabolite tracking

  • Computational screening protocols:

    • Build homology models of CYP71C2 based on related P450 structures

    • Perform virtual screening of compound libraries through molecular docking

    • Prioritize compounds for experimental validation

  • Cell-based screening systems:

    • Develop yeast or bacterial reporter systems expressing CYP71C2

    • Engineer growth-dependent or fluorescence-based readouts

    • Screen compound libraries for metabolism or inhibition

Recommended workflow for herbicide interaction studies:

  • Initial virtual screening of herbicide classes

  • Medium-throughput biochemical assays with recombinant enzyme

  • Validation in plant microsome preparations

  • Whole-plant phenotypic confirmation

This approach would enable systematic investigation of the enzyme's role in metabolizing different herbicide classes and potentially identify selective inhibitors or enhancers that could be used in resistance management strategies .

What are the key considerations for incorporating CYP71C2 knowledge into integrated weed management strategies?

Integrating CYP71C2 knowledge into weed management requires consideration of several factors:

  • Monitoring CYP71C2 expression in weed populations:

    • Develop field-applicable RT-qPCR methods for expression analysis

    • Establish baseline expression levels in susceptible populations

    • Create early warning systems for resistance development based on expression changes

  • Herbicide rotation strategies:

    • Group herbicides by their interaction with CYP71C2 (substrates, inhibitors, inducers)

    • Avoid sequential use of herbicides metabolized through similar pathways

    • Incorporate CYP71C2 inhibitors in herbicide formulations when appropriate

  • Resistance management approaches:

    • Use CYP71C2 expression as a biomarker for metabolic resistance

    • Develop diagnostic kits for rapid field assessment

    • Implement proactive resistance management when expression changes are detected

  • Knowledge integration matrix:

CYP71C2 StatusRecommended ActionMonitoring StrategyResearch Need
Down-regulatedSwitch herbicide mode of actionRegular expression analysisDetermine mechanism of down-regulation
Structurally mutatedTest alternative herbicidesGenetic screeningCharacterize impact of mutations
No changeMaintain current programPeriodic monitoringBaseline metabolism studies
  • Data sharing platform:

    • Establish a database correlating CYP71C2 expression/mutations with herbicide efficacy

    • Develop predictive models for resistance development

    • Create geographical mapping of resistance patterns based on CYP71C2 status

The observation that CYP71C2 is down-regulated in resistant plants suggests a unique metabolism pathway that differs from the typical up-regulation of detoxifying enzymes, providing a novel angle for resistance management strategies.

How should researchers interpret contradictory data regarding CYP71C2 function in different experimental systems?

When faced with contradictory data about CYP71C2, researchers should employ a systematic analytical approach:

  • Experimental system comparison:

    • Heterologous expression systems may yield different results than native plant systems

    • E. coli-expressed enzymes may lack post-translational modifications present in plants

    • Consider differences in cofactor availability and membrane environment

  • Methodological analysis:

    • Compare analytical methods and their sensitivities (e.g., RT-qPCR vs. RNA-seq for expression)

    • Evaluate assay conditions (buffers, temperature, pH) that may affect enzyme behavior

    • Consider temporal factors in sampling and analysis

  • Biological context integration:

    • Plant developmental stage influences CYP expression patterns

    • Environmental stressors can alter baseline expression levels

    • Genetic background differences may explain variant results

  • Data reconciliation framework:

Contradiction TypeAnalysis ApproachResolution StrategyReporting Recommendation
Expression level conflictsCompare normalization methodsPerform side-by-side analysisReport all methodological details
Activity differencesAnalyze assay conditionsStandardize reaction conditionsInclude all reaction parameters
Phenotypic impact variationsExamine genetic backgroundsUse isogenic linesReport complete genetic information
  • Meta-analytical approach:

    • Compile results from multiple studies with standardized effect sizes

    • Identify moderator variables that explain contradictions

    • Develop a weighted consensus based on methodological quality

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.