Recombinant Zea mays Cytochrome P450 71C4 (CYP71C4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us; we will prioritize its inclusion.
Synonyms
CYP71C4; BX2; indole-2-monooxygenase; Cytochrome P450 71C4; Protein benzoxazineless 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-538
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
CYP71C4
Target Protein Sequence
MAAQLHHALYELLHEAAAAQRALLLAIPFSLLLLPLLLRYLAASASASATKNDGAAPASD PDKLLSLLPSPPMKLPIIGHLHLMGDIPYVSLAALATRYGPDLMLLRLGAVPTVVVSSPR VAEAVLRTYDHVFSSRPRSLVSDIIMYGATDSCFAPYGDHFRKARKLVTVHLLNASKVRS QRPAREEEVRGALDRVRRAAAAREPVDMSELLHSFVNNLVCRAVSGKFSMEEGRNRLFRE LTDINAGLLGGFHIQDYFPRLGRIELVRKVACAKTRRVRKRWDDLLDKLIDDHAARMATH QDEDDDKDFIYVLLSLQKEYGLTRDHIKAILIDMFEAGTDTSYMTLEFAMTELIRKPHLM KKLQEEVRRNVPAGQEMVTEDNLPGMTDLKAVIKETLRLHPPVPLLLPHYSLDACEVAGY TIPANTRVVVNAWALGRHSGYWERENEFVPERFLSGDVAGGVDLKPNEFQFLAFGSGRRM CPGVHSASATIEAMLSNLMYRFDWQLPAGMKAEDVDMTEVFGITVSRKEKLLLVPQAA
Uniprot No.

Target Background

Function

Function: Catalyzes the conversion of indole to indolin-2-one.

Database Links
Protein Families
Cytochrome P450 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Cytochrome P450 71C4 and what is its role in maize?

Cytochrome P450 71C4 (CYP71C4) belongs to the CYP71 family of plant cytochrome P450 enzymes. It is also known as BX2 or indole-2-monooxygenase and functions as "Protein benzoxazineless 2" in maize (Zea mays) . CYP71C4 is part of a wider family of cytochrome P450 monooxygenases that play significant roles in plant biosynthetic and detoxification pathways . While the complete in vivo function remains under investigation, the enzyme is believed to be involved in secondary metabolite production, particularly in the biosynthesis of protective compounds in maize seedlings .

How does CYP71C4 relate to other cytochrome P450 enzymes in maize?

CYP71C4 is one of several cytochrome P450 enzymes in maize that belong to the CYP71 family. It shares functional and structural relationships with other members such as CYP71C1 and CYP71C3, which are involved in the DIMBOA (2,4-dihydroxy-7-methoxy-1,4-benzoxazin-3-one) biosynthetic pathway . The divergence among members of the maize CYP71C gene family is sufficient to account for different substrate and/or reaction specificities, suggesting functional specialization . Interestingly, like in animals, the mapping of maize CYPzm genes shows that P450 genes of the same family can be clustered, indicating that distinct plant P450 gene families may have been generated by gene duplication .

What are the temporal and spatial expression patterns of CYP71C4 in maize?

The expression of CYP71C4 and related cytochrome P450 genes in maize follows a transient and seedling-specific expression pattern. Research has shown that:

  • Maximum steady-state mRNA levels are reached at 3 days in root tissue and at 7 days in shoot tissue

  • In situ hybridization reveals highest mRNA levels in specific tissues including:

    • The coleoptile

    • First developed leaflets

    • Ground tissue of the nodular complex

    • Cortex and pith of the cell division region in the root

Expression levels vary among different maize lines, although the general expression pattern remains consistent . The temporal expression pattern suggests a developmental role specifically in early growth stages of the maize plant.

How do environmental factors and chemical inducers affect CYP71C4 expression?

The expression of CYP71C4 and related cytochrome P450s responds to various environmental factors and chemical treatments. Related P450s in the same family (CYP71C1 and CYP71C3) show induction in response to:

  • Chemical inducers such as naphthalic anhydride (NA) and triasulfuron (T)

  • Wounding stress

  • Pathogen exposure (including bacteria like Erwinia stuartii and Acidovorax avenae)

Each P450 transcript has distinct developmental, tissue-specific, and chemical cues regulating their expression, even when they encode P450s within the same biosynthetic pathway . This suggests a complex regulatory network controlling the expression of these enzymes in response to both developmental and environmental signals.

What regulatory elements control CYP71C4 gene expression?

While the specific regulatory elements controlling CYP71C4 have not been fully characterized in the provided research, studies on related cytochrome P450 genes in the same family provide insights. These genes typically contain:

  • Promoter elements responsive to wounding

  • Chemical-responsive elements (particularly for xenobiotics like herbicides and their safeners)

  • Developmental stage-specific regulatory elements

The presence of the CYP71C gene cluster in maize, similar to clustered P450 genes in animals, suggests coordinated regulation within the genome architecture . This clustering may facilitate coordinated expression patterns when these enzymes function in the same biochemical pathway.

What are the most effective methods for recombinant expression of CYP71C4?

Successful recombinant expression of CYP71C4 has been achieved using the following approach:

  • Expression System: E. coli has been successfully used for the expression of recombinant CYP71C4 with an N-terminal His-tag

  • Construct Design:

    • The full-length protein (amino acids 1-538) should be included

    • Addition of an N-terminal His-tag facilitates purification via affinity chromatography

  • Purification Protocol:

    • Use affinity chromatography with His-tag-binding resins

    • Purified protein should be stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Storage Considerations:

    • Store at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles

    • Aliquoting is necessary for multiple use

    • Addition of 5-50% glycerol (final concentration) is recommended for long-term storage

For alternative heterologous expression, Saccharomyces cerevisiae expression systems have been successfully used for related plant cytochrome P450s, which could be adapted for CYP71C4 .

What are the challenges in detecting CYP71C4 activity in vitro and how can they be overcome?

Several challenges exist when studying CYP71C4 activity in vitro:

  • Low natural abundance: P450 enzymes often represent transcripts of low abundance in plant tissues, making direct purification challenging

  • Membrane association: As a cytochrome P450, CYP71C4 is membrane-bound, which complicates purification and activity assays

  • Requirement for electron transport partners: P450 enzymes require appropriate redox partners for catalytic activity

To overcome these challenges, researchers can:

  • Use recombinant systems with co-expression of redox partners: Especially NADPH-cytochrome P450 reductase

  • Employ surrogate substrates: General P450 substrates like 7-ethoxycoumarin can be used to detect activity through deethylation assays (ECOD)

  • Conduct inhibition studies: Identify potential natural substrates by testing their ability to competitively inhibit the metabolism of artificial substrates

  • Apply spectroscopic methods: Carbon monoxide difference spectroscopy and substrate binding difference spectra can confirm proper folding and substrate interactions

What are the advanced methods for studying CYP71C4 gene expression?

Researchers have employed several sophisticated techniques to study CYP71C4 and related P450 gene expression:

  • RT-PCR and Quantitative RT-PCR:

    • For amplification of CYP71C4 fragments from total RNA

    • Can detect low-abundance transcripts

    • Allows quantification of expression levels under different conditions

  • Northern Analysis:

    • For evaluating tissue-specific and condition-dependent expression

    • Requires poly(A)+ mRNA hybridization with specific P450 cDNA probes

    • Normalization using constitutive transcripts (like maize 1055 cDNA) allows accurate quantification of induction levels

  • In Situ Hybridization:

    • Reveals spatial expression patterns within tissues

    • Particularly useful for localizing expression to specific cell types

  • Genomic Southern Analysis:

    • Confirms gene presence and copy number in the genome

    • Helps identify gene clustering and organization

  • cDNA Library Screening:

    • Using degenerate primers directed to conserved regions for initial identification

    • Phage λ libraries of various tissues can be screened to isolate full-length clones

What are the known substrates and enzymatic activities of CYP71C4?

Based on the available research, CYP71C4 (also known as BX2 or indole-2-monooxygenase) is involved in the biosynthetic pathway of protective compounds in maize. While the specific catalytic activity has not been fully characterized, its designation as "indole-2-monooxygenase" suggests it may catalyze the oxidation of indole compounds .

CYP71C4's relationship to the CYP71 family suggests its involvement in secondary metabolism. Other members of this family, such as CYP71C1 and CYP71C3, are involved in the DIMBOA biosynthetic pathway, which produces benzoxazinoid compounds that serve as defensive metabolites in maize .

For experimental characterization, researchers studying related P450 enzymes have used:

  • Artificial substrates like 7-ethoxycoumarin to assess general P450 activity

  • Substrate binding assays using spectral shift analysis

  • Inhibition studies with potential natural substrates

How can substrate specificity of CYP71C4 be determined experimentally?

Determining substrate specificity for CYP71C4 can be approached through several complementary methods:

  • Spectral Binding Assays:

    • Monitoring spectral shifts upon substrate binding

    • Type I shifts (peak at 385-390 nm, trough at 420 nm) indicate substrate binding

    • Type II shifts (peak at 430 nm, trough at 390-410 nm) indicate inhibitor binding

  • Competitive Inhibition Studies:

    • Using a known substrate/activity (like 7-ethoxycoumarin O-deethylation)

    • Testing potential natural substrates for inhibition of this activity

    • Compounds showing inhibition are candidate physiological substrates

  • Direct Metabolite Analysis:

    • Incubating purified enzyme with potential substrates

    • Analyzing reaction products using HPLC, LC-MS, or GC-MS

    • Identifying structural changes to the substrate molecules

  • Comparative Analysis with Related Enzymes:

    • Testing substrates of related CYP71 family enzymes

    • The 36.2% identity with other characterized P450s provides hints to potential substrate classes

What is the relationship between CYP71C4 and plant defense mechanisms?

CYP71C4 (BX2) is believed to play a role in plant defense mechanisms through its involvement in the biosynthesis of protective secondary metabolites. Its relationship to other CYP71C family members involved in DIMBOA biosynthesis suggests it may participate in similar protective pathways .

Key points regarding the defensive role include:

  • Benzoxazinoid Production: Related enzymes in the same family are involved in producing benzoxazinoids like DIMBOA, which function as:

    • Natural pesticides against insects

    • Antimicrobial compounds against pathogens

    • Allelochemicals affecting other plants

  • Induction by Stress: The induction of related CYP71 family genes in response to:

    • Wounding

    • Pathogen exposure (including bacteria like Erwinia stuartii and Acidovorax avenae)

    • Chemical stressors like herbicides and their safeners

  • Developmental Regulation: The seedling-specific expression pattern suggests a protective role during vulnerable early growth stages of the plant

Understanding CYP71C4's precise role in defense requires further characterization of its specific substrates and products, which remains an active area of research.

How does CYP71C4 compare structurally and functionally to other plant P450 enzymes?

CYP71C4 shares structural and potentially functional similarities with other plant cytochrome P450 enzymes while maintaining distinct characteristics:

FeatureCYP71C4Related Plant P450sNotes
Sequence Identity-36.2% identity over 475 amino acids with other characterized P450s Moderate conservation suggests similar but distinct functions
Family ClassificationCYP71C familyCYP71 family includes enzymes from avocado fruit (CYP71A1) and eggplant hypocotyls (CYP71A2, A3, A4) Part of a diverse family with members across monocots and dicots
Membrane AssociationContains transmembrane domainCommon feature of microsomal P450sRequired for proper localization to endoplasmic reticulum
Conserved DomainsContains P450 signature sequencesCommon among all P450sIncludes heme-binding domain and oxygen-binding pocket
Expression PatternSeedling-specificVarious patterns depending on functionSpecialized temporal expression suggests specific developmental roles

The divergence among members of the maize gene family, including CYP71C4, is sufficiently high to account for different substrate and/or reaction specificity while maintaining the core P450 catalytic function .

What can evolutionary analysis reveal about the origin and specialization of CYP71C4?

Evolutionary analysis of CYP71C4 and related cytochrome P450 genes provides several insights:

  • Gene Duplication: The presence of the CYPzm gene cluster in maize suggests that distinct plant P450 gene families were generated by gene duplication events, similar to the pattern observed in animals

  • Functional Diversification: The divergence within the CYP71 family indicates evolutionary specialization for different substrates and reactions, allowing plants to adapt their metabolic capabilities

  • Conservation Across Plant Species: The expression of related P450 genes in both monocot (like maize) and dicot plants indicates that these enzymes play significant evolutionary conserved roles in plants

  • Subfamily Specialization: The CYP71C subfamily in maize appears specialized for particular biosynthetic pathways, such as those involved in benzoxazinoid production, suggesting adaptation to specific ecological pressures

These evolutionary patterns help explain how plants have developed diverse metabolic capabilities to respond to environmental challenges and developmental needs throughout their evolutionary history.

How do monocot and dicot CYP71 family members differ in structure and function?

The CYP71 family is present in both monocot plants (like maize) and dicot plants (like avocado and eggplant), with notable similarities and differences:

  • Sequence Conservation: CYP71C4 and other maize P450s in the CYP71 family are related to the CYP71 family from dicots, including enzymes from avocado fruit (CYP71A1) and eggplant hypocotyls (CYP71A2, A3, A4)

  • Subfamily Specialization:

    • Monocots: The CYP71C subfamily in maize appears specialized for benzoxazinoid biosynthesis

    • Dicots: The CYP71A subfamily members have diverse functions in different species

  • Expression Patterns:

    • Both monocot and dicot CYP71 family members show tissue-specific and developmentally regulated expression

    • The specific timing and localization differ based on species-specific requirements

  • Metabolic Pathways:

    • Monocot CYP71C enzymes: Often involved in benzoxazinoid biosynthesis

    • Dicot CYP71 enzymes: Involved in various secondary metabolite pathways depending on species

The presence of related P450 genes across the plant kingdom indicates that these enzymes play evolutionarily significant roles, but their specific functions have diversified to meet the unique ecological and developmental needs of different plant lineages.

How can recombinant CYP71C4 be used in metabolic engineering applications?

Recombinant CYP71C4 has potential applications in metabolic engineering projects, particularly those aimed at enhancing plant defense mechanisms or producing valuable secondary metabolites:

  • Engineering Enhanced Plant Defenses:

    • Introducing or overexpressing CYP71C4 in plants could potentially enhance their resistance to pests and pathogens

    • The seedling-specific expression pattern makes it suitable for enhancing early-stage plant protection

  • Heterologous Production of Bioactive Compounds:

    • Once the specific reaction and substrates are fully characterized, CYP71C4 could be used in microbial systems to produce valuable plant metabolites

    • Expression in systems like E. coli or yeast allows for scalable production of plant compounds

  • Pathway Reconstruction:

    • Co-expression with other enzymes in the same biosynthetic pathway could reconstitute the complete pathway in heterologous systems

    • This approach allows production of complex plant metabolites in microbial hosts

  • Enzyme Engineering:

    • Structure-function studies of CYP71C4 could inform protein engineering efforts to alter substrate specificity or improve catalytic efficiency

    • This could lead to novel enzymatic activities for biotechnological applications

What are the best practices for long-term storage and handling of recombinant CYP71C4?

For optimal stability and activity of recombinant CYP71C4 protein, the following best practices should be followed:

  • Storage Conditions:

    • Store at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Buffer Composition:

    • Recommended storage buffer: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • For long-term storage, addition of 5-50% glycerol (final concentration) is recommended

  • Reconstitution Protocol:

    • Briefly centrifuge vial prior to opening to bring contents to the bottom

    • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Activity Preservation:

    • Avoid repeated freeze-thaw cycles as this significantly reduces enzymatic activity

    • Include appropriate cofactors or stabilizing agents when conducting activity assays

    • Consider the need for lipid or membrane components to maintain proper folding

What are the advanced spectroscopic methods for analyzing CYP71C4 structure and function?

Several sophisticated spectroscopic techniques can be employed to study the structure and function of CYP71C4:

  • UV-Visible Spectroscopy:

    • Carbon monoxide difference spectroscopy (CO-difference spectrum) showing the characteristic absorption maximum at 450 nm confirms proper folding of the recombinant P450

    • Substrate binding can be monitored through spectral changes (Type I or Type II shifts)

    • Quantification of P450 concentration can be determined using the extinction coefficient

  • Resonance Raman Spectroscopy:

    • Provides information about the heme environment and its changes upon substrate binding

    • Can detect subtle changes in the iron coordination and spin state

  • Circular Dichroism (CD):

    • Analyzes secondary structure elements (α-helices, β-sheets) and their changes upon substrate binding

    • Useful for monitoring protein folding and stability under different conditions

  • Electron Paramagnetic Resonance (EPR):

    • Provides information about the electronic structure of the heme iron

    • Can distinguish between different oxidation and spin states during the catalytic cycle

  • X-ray Absorption Spectroscopy:

    • Provides detailed information about the local environment of the heme iron

    • Useful for studying the enzyme in solution without crystallization requirements

These spectroscopic methods, combined with functional assays, provide a comprehensive view of CYP71C4 structure-function relationships and catalytic mechanisms.

What are the common issues in recombinant expression of CYP71C4 and how can they be resolved?

Researchers often encounter several challenges when expressing recombinant CYP71C4:

  • Low Expression Levels:

    • Problem: Insufficient protein yield for analysis

    • Solutions:

      • Optimize codon usage for the expression host

      • Try different expression systems (E. coli, yeast, insect cells)

      • Use stronger promoters or optimize induction conditions

      • Co-express molecular chaperones to aid proper folding

  • Protein Insolubility/Inclusion Body Formation:

    • Problem: Expressed protein forms insoluble aggregates

    • Solutions:

      • Lower induction temperature (16-20°C)

      • Reduce inducer concentration

      • Express as fusion with solubility-enhancing tags (beyond just His-tag)

      • Use specialized E. coli strains designed for membrane protein expression

  • Improper Folding:

    • Problem: Protein lacks characteristic P450 spectral properties

    • Solutions:

      • Supplement growth medium with δ-aminolevulinic acid (ALA) to enhance heme biosynthesis

      • Co-express cytochrome P450 reductase

      • Include membrane-mimicking environments during purification

  • Low Activity:

    • Problem: Purified enzyme shows poor catalytic activity

    • Solutions:

      • Ensure presence of appropriate redox partners

      • Optimize buffer conditions (pH, ionic strength)

      • Add lipids or detergents to mimic membrane environment

      • Test different substrate concentrations

How can contradictory results in CYP71C4 expression studies be reconciled?

When faced with contradictory results in CYP71C4 expression studies, consider the following methodological approaches:

  • Standardize Experimental Conditions:

    • Different maize lines show variation in maximum steady-state mRNA levels despite identical general expression patterns

    • Ensure consistent growth conditions, sampling times, and tissue selection

    • Use the same reference genes for normalization across studies

  • Consider Developmental Timing:

    • CYP71C4 expression is highly developmental stage-dependent (3 days in root, 7 days in shoot)

    • Small differences in sampling time can lead to significant expression differences

    • Create detailed time-course studies to map expression dynamics

  • Evaluate Tissue Specificity:

    • In situ hybridization reveals expression limited to specific tissues

    • Whole-organ analyses may dilute signal from highly localized expression

    • Use microdissection or single-cell approaches for precise localization

  • Assess Induction Conditions:

    • Related P450s show complex responses to chemical inducers and stress

    • Carefully document all treatments and environmental conditions

    • Consider cross-talk between different signaling pathways

  • Compare Multiple Detection Methods:

    • Combine techniques (RT-PCR, Northern blotting, in situ hybridization)

    • Each method has different sensitivity and specificity profiles

    • Protein-level studies (Western blotting, activity assays) should complement transcript analyses

What strategies can overcome difficulties in determining the physiological substrates of CYP71C4?

Identifying the true physiological substrates of CYP71C4 presents significant challenges. These strategies can help overcome these difficulties:

  • Comparative Genomics Approach:

    • Analyze co-expression patterns with genes of known function

    • Identify metabolic pathways that correlate with CYP71C4 expression

    • Compare with characterized homologs in other species (like the 36.2% identical P450)

  • Metabolomics Screening:

    • Compare metabolite profiles between wild-type plants and those with altered CYP71C4 expression

    • Focus on metabolites that accumulate in knockdown/knockout lines

    • Look for intermediates that disappear in overexpression lines

  • In vitro Screening with Substrate Libraries:

    • Test binding and activity with collections of potential substrates

    • Start with compounds related to indoles (given the "indole-2-monooxygenase" annotation)

    • Use spectral binding assays as initial filter before activity testing

  • Enzyme Assay Optimization:

    • Reconstruct complete pathways by including potential partner enzymes

    • Test cofactor requirements and optimal reaction conditions

    • Use sensitive analytical methods (LC-MS/MS) to detect low-abundance products

  • Genetic Approaches:

    • Create knockout/knockdown lines and analyze phenotypic changes

    • Perform complementation studies with related P450s

    • Use heterologous expression in plants lacking the specific pathway

By combining these approaches, researchers can build a weight of evidence to identify the true physiological substrates and functions of CYP71C4.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.