Recombinant Zea mays Derlin-1.1 (DER1.1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
DER1.1; SOR; Derlin-1.1; ZmDerlin1-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-243
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
DER1.1
Target Protein Sequence
MSSPAEYYKSLPPISKAYGTLCFFTTVLVQLQILHPLFLYLDYPLVFKKFEIWRLLTSFF FLAPFSMKFGIRLLMIARYGVMLEKGAFDKRTADFLWMMIFGAISLLVLSIIPLFNSFFL GIPMVSMLLYVWSRENPNAQINIYGLVQLRSFYLPWAMLLLDVIFGSSLMPGLLGIMVGH LYYFFAVLHPLATGKSYLKTPKWVHKIVARFRIGMQANSPVRPPANGNSGSGVFRGRSYR LNQ
Uniprot No.

Target Background

Function
Derlin-1.1 (DER1.1) may be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins.
Database Links
Protein Families
Derlin family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in roots, stalks, leaves, immature ears, embryo and endosperm.

Q&A

What is Zea mays Derlin-1.1 and what is its role in plants?

Zea mays Derlin-1.1 (DER1.1), also known as ZmDerlin1-1, is a transmembrane protein found in maize (Zea mays) with UniProt ID Q4G2J6 . Derlins are evolutionarily conserved proteins involved in endoplasmic reticulum-associated protein degradation (ERAD) pathways. In plants, Derlin proteins typically participate in protein quality control mechanisms by facilitating the retrotranslocation of misfolded proteins from the endoplasmic reticulum to the cytosol for degradation. This function is crucial for maintaining cellular homeostasis, especially under stress conditions that can lead to accumulation of misfolded proteins.

What are the recommended storage conditions for recombinant Derlin-1.1?

For optimal stability of recombinant Derlin-1.1, the following storage conditions are recommended :

FormShort-term StorageLong-term StorageShelf Life
Liquid4°C (up to one week)-20°C/-80°C6 months
LyophilizedNot specified-20°C/-80°C12 months

Repeated freeze-thaw cycles should be avoided as they can lead to protein degradation and loss of biological activity . It is advisable to make working aliquots to minimize freeze-thaw cycles. For reconstituted protein, adding glycerol to a final concentration of 5-50% (with 50% being optimal) before aliquoting is recommended for long-term storage at -20°C/-80°C .

What expression systems are suitable for producing recombinant Derlin-1.1?

Based on the available data, E. coli-based expression systems have been successfully used to produce recombinant Zea mays Derlin-1.1 . When designing an expression strategy, researchers should consider:

  • Expression vector selection: Vectors with strong, inducible promoters (e.g., T7) are typically used for transmembrane proteins

  • E. coli strain: BL21(DE3) or derivatives are commonly used for recombinant protein expression

  • Expression conditions: Optimization of temperature, induction time, and inducer concentration is critical

  • Fusion tags: N-terminal His-tags (10xHis) have been successfully used with Derlin-1.1

While E. coli systems are well-documented for Derlin-1.1 expression, researchers exploring alternative expression platforms should consider yeast systems for eukaryotic post-translational modifications or insect cell systems for improved folding of transmembrane domains.

What is the recommended protocol for reconstituting lyophilized Derlin-1.1?

The recommended reconstitution protocol for lyophilized Derlin-1.1 involves the following steps :

  • Briefly centrifuge the vial containing lyophilized protein before opening to ensure the material is at the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to a final concentration of 5-50% (50% is recommended)

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Store aliquots at -20°C/-80°C for extended shelf life

The reconstitution buffer contains Tris/PBS with 6% trehalose at pH 8.0 . Trehalose serves as a stabilizing agent that helps maintain protein integrity during freeze-thaw cycles.

How can researchers verify the integrity and functionality of purified Derlin-1.1?

To verify the integrity and functionality of purified Derlin-1.1, researchers should employ multiple complementary approaches:

  • SDS-PAGE analysis: To confirm protein size (expected MW ~27 kDa plus tag contributions) and purity (should be >90%)

  • Western blotting: Using anti-His antibodies or specific anti-Derlin-1.1 antibodies

  • Circular dichroism (CD) spectroscopy: To assess secondary structure, particularly important for transmembrane proteins

  • Functional assays:

    • Protein-protein interaction assays with known binding partners

    • Reconstitution in liposomes to assess membrane integration

    • ERAD pathway component binding assays

When designing validation experiments, researchers should include appropriate positive and negative controls to establish baseline comparisons.

What are potential protein-protein interaction partners of Derlin-1.1 in Zea mays?

While the search results don't specifically address Derlin-1.1 interaction partners, we can infer potential interactions based on known Derlin functions and interactions of other proteins in Zea mays. In general, Derlin proteins typically interact with:

  • ERAD machinery components

  • E3 ubiquitin ligases

  • Misfolded substrate proteins

  • Other quality control proteins

In Zea mays, protein-protein interaction analysis of other proteins has revealed interaction networks involving stress response proteins . For example, methodologies used to identify superoxide dismutase (SOD2) interactions could be adapted to study Derlin-1.1 interactions. These approaches include:

  • Yeast two-hybrid screening

  • Co-immunoprecipitation followed by mass spectrometry

  • Bimolecular fluorescence complementation

  • Proximity-dependent biotin identification (BioID)

When designing protein-protein interaction studies, researchers should consider both the transmembrane nature of Derlin-1.1 and the potential for transient interactions.

What methodological considerations are important when designing experiments with transmembrane proteins like Derlin-1.1?

Working with transmembrane proteins presents unique challenges that researchers should address through careful experimental design:

  • Solubilization strategies:

    • Selection of appropriate detergents (e.g., mild non-ionic detergents like DDM or CHAPS)

    • Detergent concentration optimization to maintain native structure

    • Consider detergent-free approaches using nanodiscs or amphipols

  • Buffer composition:

    • Include stabilizing agents like glycerol or trehalose

    • Optimize pH and ionic strength for stability

    • Consider adding protease inhibitors to prevent degradation

  • Structural analysis:

    • Cryo-EM or X-ray crystallography with appropriate modifications for membrane proteins

    • NMR approaches specific for transmembrane domains

    • Molecular dynamics simulations to predict structural behavior

  • Functional assays:

    • Reconstitution in artificial membrane systems

    • Designing topology-specific probes or antibodies

    • Developing cell-based assays that account for membrane localization

Following the purpose-procedure format described in scientific method writing is essential when documenting these methodological considerations.

How can Derlin-1.1 be studied in the context of plant stress responses?

Derlin-1.1 likely plays a role in plant stress responses through its involvement in ERAD pathways. To investigate this function, researchers can design experiments that:

  • Generate Derlin-1.1 knockout or overexpression lines in maize using techniques similar to those used for other maize genes

  • Expose plants to various stressors and monitor:

    • Derlin-1.1 expression levels using RT-qPCR

    • Protein accumulation using immunoblotting

    • Subcellular localization changes using fluorescent protein fusions

    • Global proteome changes using quantitative proteomics

  • Analyze ER stress indicators:

    • Unfolded protein response activation

    • Accumulation of polyubiquitinated proteins

    • ER morphology changes

  • Perform comparative analyses:

    • Between wild-type and Derlin-1.1 mutant plants

    • Across different stress conditions

    • Between Zea mays and other plant species

The experimental design should include appropriate controls and statistical analyses as described in methods section guidelines .

What genomic approaches can be used to study Derlin-1.1 variation across maize populations?

To study Derlin-1.1 genetic variation across maize populations, researchers can employ approaches similar to those used in studying other maize genes :

  • Population genetics approaches:

    • Sequencing Derlin-1.1 across diverse maize inbred lines to identify SNPs and InDels

    • Analyzing haplotype structure and diversity

    • Calculating population genetic statistics (π, Tajima's D, FST)

  • Association studies:

    • Conduct genome-wide association studies (GWAS) to identify associations between Derlin-1.1 variants and phenotypic traits

    • Analyze Derlin-1.1 expression quantitative trait loci (eQTLs)

    • Investigate epistatic interactions with other genes

  • Comparative genomics:

    • Compare Derlin-1.1 sequences across grass species

    • Identify conserved regulatory elements

    • Analyze selection signatures

  • Recombination analysis:

    • Characterize recombination patterns around the Derlin-1.1 locus

    • Determine if Derlin-1.1 is located in recombination hot spots or cold spots

    • Study the impact of structural variations on recombination

These approaches require population-level sampling and high-throughput sequencing technologies, along with appropriate bioinformatic pipelines for data analysis.

What strategies can be employed to design specific antibodies against Derlin-1.1?

Designing specific antibodies against transmembrane proteins like Derlin-1.1 requires careful consideration of protein topology and antigenic regions. Recommended strategies include:

  • Epitope selection:

    • Identify hydrophilic, surface-exposed regions using prediction algorithms

    • Target unique regions not conserved in other Derlin family members

    • Avoid highly conserved transmembrane domains

  • Antigen preparation options:

    • Synthetic peptides corresponding to hydrophilic loops

    • Recombinant protein fragments of extramembrane domains

    • Full-length protein in appropriate detergent micelles

  • Antibody production approaches:

    • Polyclonal antibodies: Faster production but potential cross-reactivity

    • Monoclonal antibodies: Higher specificity but more resource-intensive

    • Recombinant antibodies: Allows for engineering specificity

  • Validation methods:

    • Western blot against recombinant protein and native extracts

    • Immunoprecipitation followed by mass spectrometry

    • Immunofluorescence in wild-type vs. knockout backgrounds

    • Peptide competition assays

For transmembrane proteins, antibodies targeting N-terminal or C-terminal regions often yield better results than those targeting transmembrane segments.

What are common issues in recombinant Derlin-1.1 expression and how can they be addressed?

Researchers commonly encounter several challenges when expressing transmembrane proteins like Derlin-1.1:

ChallengePotential CausesSolutions
Low expression yieldToxicity to host cells, codon biasUse C41/C43 E. coli strains, codon optimization, lower induction temperature (16-20°C)
Inclusion body formationProtein misfolding, overexpressionReduce expression rate, use solubility tags, optimize buffer conditions
Protein degradationProtease activityInclude protease inhibitors, use protease-deficient host strains
Poor solubilityHydrophobic transmembrane domainsOptimize detergent selection, use specialized solubilization buffers
Loss of activityImproper folding, loss of cofactorsOptimize purification conditions, reconstitute in lipid environments

When troubleshooting expression issues, a systematic approach of changing one variable at a time while keeping others constant is recommended to identify optimal conditions.

How can researchers address experimental variability when working with Derlin-1.1?

To minimize experimental variability when working with Derlin-1.1, researchers should implement the following best practices:

  • Standardize protein preparation:

    • Use consistent expression and purification protocols

    • Implement quality control steps (SDS-PAGE, Western blot)

    • Quantify protein concentration using multiple methods

    • Prepare single-use aliquots to avoid freeze-thaw cycles

  • Experimental design considerations:

    • Include appropriate positive and negative controls

    • Perform technical and biological replicates

    • Randomize sample order to minimize systematic bias

    • Use consistent buffer compositions and experimental conditions

  • Data analysis approaches:

    • Apply appropriate statistical tests for the experimental design

    • Consider power analysis to determine adequate sample sizes

    • Use data normalization methods when comparing across experiments

    • Report variability measures (standard deviation, standard error)

  • Documentation practices:

    • Record detailed protocols following methods section guidelines

    • Document lot numbers of recombinant proteins

    • Note any deviations from standard protocols

    • Maintain comprehensive laboratory notebooks

Following these practices will enhance reproducibility and reliability of results involving Derlin-1.1.

How might Derlin-1.1 function in specialized plant tissues or developmental stages?

Understanding the tissue-specific and developmental roles of Derlin-1.1 represents an emerging research direction. To investigate these aspects, researchers can:

  • Analyze tissue-specific expression patterns:

    • Perform RT-qPCR across different tissues and developmental stages

    • Analyze publicly available RNA-seq datasets from maize tissues

    • Create promoter-reporter constructs to visualize expression patterns

  • Generate tissue-specific knockdown or overexpression lines:

    • Use tissue-specific promoters to drive Derlin-1.1 expression

    • Apply CRISPR-Cas9 with tissue-specific promoters for targeted editing

    • Develop inducible expression systems to control timing

  • Investigate protein-protein interactions in specific contexts:

    • Perform co-immunoprecipitation from different tissues

    • Use proximity labeling approaches in specific cell types

    • Apply single-cell proteomics to identify cell-specific interactions

  • Examine phenotypic effects in specialized tissues:

    • Analyze ER stress markers in different tissues

    • Investigate developmental abnormalities in mutant lines

    • Study responses to tissue-specific stressors

These approaches can reveal specialized functions of Derlin-1.1 beyond its canonical role in ERAD pathways.

What are the prospects for using Derlin-1.1 in biotechnological applications?

While Derlin-1.1 is primarily studied in basic research contexts, several potential biotechnological applications could emerge:

  • Stress tolerance engineering:

    • Modifying Derlin-1.1 expression or function to enhance plant stress resilience

    • Creating crops with improved ER stress management capabilities

    • Developing stress-specific expression systems based on Derlin-1.1 regulatory elements

  • Protein production systems:

    • Utilizing Derlin-1.1 knowledge to improve recombinant protein expression in plants

    • Engineering ERAD pathways for controlled protein degradation

    • Developing new tools for difficult-to-express proteins

  • Biosensor development:

    • Creating sensors for ER stress based on Derlin-1.1 interactions

    • Developing screening systems for compounds that modulate ERAD

    • Engineering reporter systems for protein misfolding in plants

  • Comparative studies across crop species:

    • Transferring knowledge from maize to other important crop species

    • Identifying species-specific adaptations in ERAD systems

    • Developing broad-spectrum crop improvement strategies

These applications require thorough understanding of Derlin-1.1 function and regulation, highlighting the importance of basic research in this area.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.