Recombinant Zea mays Derlin-1.2 (DER1.2)

Shipped with Ice Packs
In Stock

Description

Functional Role in ER-Associated Degradation (ERAD)

DER1.2 belongs to the Derlin family of rhomboid pseudoproteases, which facilitate retrotranslocation of misfolded proteins from the ER lumen to the cytosol for proteasomal degradation . Key findings include:

  • Conservation: Complements yeast Der1Δ mutants, confirming functional homology across species .

  • ER Stress Response: Expression upregulated during ER stress, particularly in secretory tissues like developing maize endosperm .

  • Substrate Engagement: Interacts with ERAD machinery (e.g., Cdc48/p97 ATPase) via a conserved SHP motif, enabling extraction of ubiquitinated substrates .

Domain Architecture

  • Transmembrane Helices: Four predicted helices critical for membrane integration .

  • Rhomboid-like Motifs: Conserved residues in Loop 1 (L1) and Loop 2 (L2) mediate substrate binding and lipid bilayer remodeling .

Retrotranslocation Mechanism

  • Lipid Thinning: Derlins induce local membrane thinning to facilitate substrate extraction, a feature conserved in human Derlin-1 .

  • Cdc48 Recruitment: The SHP motif (residues 174–178) binds Cdc48, coupling substrate retrotranslocation to ATP-driven dislocation .

Research Applications

Recombinant DER1.2 is widely used in:

  1. ERAD Pathway Studies: Elucidating substrate recognition and retrotranslocation in plants .

  2. Protein Interaction Assays: Identifying binding partners via pull-down or yeast two-hybrid screens .

  3. Stress Response Modeling: Investigating ER stress adaptation in maize and other cereals .

Comparative Analysis with Other Derlins

FeatureZm Derlin1-2Yeast Dfm1Human Derlin-1
Substrate SpecificityERAD-M (membrane)ERAD-MERAD-M
SHP MotifPresent (Cdc48 binding)PresentPresent
Stress InductionStrong (ER stress)ConstitutiveConstitutive
Lipid RemodelingYes Yes Yes

Future Directions

Current research focuses on:

  • Structural resolution of DER1.2-substrate complexes.

  • Engineering stress-tolerant maize variants via DER1.2 overexpression.

  • Role of DER1.2 in pathogen-induced ER stress responses.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will prepare accordingly.
Lead Time
Delivery time may vary based on the purchasing method or location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. For dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type will be decided during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
DER1.2; SOR; Derlin-1.2; ZmDerlin1-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-243
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
DER1.2
Target Protein Sequence
MSSPAEYYKSLPPISKAYGTLCFFTTVLVRLHILNPLFLYLYYPRVFKKFEVWRIFTSFF FLGPFSINFGIRLLMIARYGVMLEKGAFDKRTADFLWMMIFGAISLLVLSVIPQLNTYVL GLPMVSMLVYVWSRENPNAQINIYGILQLKAFYLPWVMLLLDVIFGSPLMPGLLGIMVGH LYYYFAVLHPLATGKNYLKTPKWVHKIVARFRIGMQANAPVRAPANGNAGTGAFRGRSYR LNQ
Uniprot No.

Target Background

Function
Derlin-1.2 (DER1.2) may play a role in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins.
Database Links

KEGG: zma:606470

STRING: 4577.GRMZM2G143817_P01

UniGene: Zm.21294

Protein Families
Derlin family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in roots and endosperm.

Q&A

What is Derlin-1.2 and what is its role in Zea mays?

Derlin-1.2 (DER1.2) is a transmembrane protein belonging to the rhomboid superfamily found in maize (Zea mays). The protein plays an essential role in the endoplasmic reticulum-associated degradation (ERAD) pathway, which is responsible for the removal of misfolded proteins from the ER. Based on homology with other derlins studied in yeast and human systems, maize Derlin-1.2 likely functions as a retrotranslocation channel component that facilitates the movement of ERAD substrates from the ER lumen to the cytosol for subsequent ubiquitination and degradation by the proteasome .

The full-length Zea mays Derlin-1.2 consists of 243 amino acids with several transmembrane segments. Sequence analysis shows conserved functional motifs including the characteristic WR motif that is found in the Derlin family and is critical for their function in ERAD .

What expression systems are most efficient for producing recombinant Derlin-1.2?

For research applications requiring properly folded transmembrane proteins, the following methodological approaches are recommended:

  • E. coli-based expression: Using specialized E. coli strains (such as C41/C43 or Rosetta) that are optimized for membrane protein expression. Induction should be performed at lower temperatures (16-20°C) with reduced IPTG concentration (0.1-0.5 mM) to slow protein production and improve folding .

  • Plant-based expression systems: For more native-like post-translational modifications and folding, transient expression in plant systems like Nicotiana benthamiana can be employed using Agrobacterium-mediated gene delivery. This approach is particularly useful when studying protein-protein interactions in a more physiologically relevant context .

  • Insect cell expression: Baculovirus expression systems in insect cells offer a eukaryotic environment that can facilitate proper folding of complex transmembrane proteins while providing higher yields than mammalian cell systems.

Selection of the appropriate expression system should be guided by the specific experimental requirements and downstream applications.

What purification strategies work best for recombinant Derlin-1.2?

Purification of recombinant Derlin-1.2 requires specialized approaches due to its transmembrane nature:

  • Detergent extraction: The protein must first be solubilized from membranes using mild detergents such as n-dodecyl β-D-maltoside (DDM), Triton X-100, or CHAPS at concentrations just above their critical micelle concentration (CMC).

  • Immobilized metal affinity chromatography (IMAC): For His-tagged recombinant Derlin-1.2, Ni-NTA or Co-NTA resins provide efficient purification. The following protocol is recommended:

    • Equilibrate resin with buffer containing 20 mM Tris-HCl (pH 8.0), 150 mM NaCl, and detergent at 2× CMC

    • Bind solubilized protein for 1-2 hours at 4°C

    • Wash with increasing imidazole concentrations (10-30 mM)

    • Elute with 250-300 mM imidazole

  • Size exclusion chromatography: As a polishing step to remove aggregates and ensure homogeneity, using Superdex 200 or similar matrices.

The purity and integrity of the purified protein should be verified by SDS-PAGE and Western blotting using anti-His antibodies or specific antibodies against Derlin-1.2 .

How can researchers assess the functionality of recombinant Derlin-1.2 in vitro?

Several approaches can be employed to assess the functionality of purified recombinant Derlin-1.2:

  • Reconstitution into liposomes: Derlin-1.2 can be incorporated into artificial lipid bilayers to study its channel or retrotranslocation activity. This can be monitored using fluorescently labeled substrate proteins and measuring their transport across the membrane.

  • Binding assays with ERAD pathway components: Pull-down or co-immunoprecipitation experiments to detect interactions with known ERAD components such as E3 ubiquitin ligases, Cdc48/p97, or specific ERAD substrates.

  • Electrophysiological measurements: If Derlin-1.2 forms a channel, patch-clamp recordings of proteoliposomes can provide insights into channel properties and substrate specificity.

  • Structure analysis: Circular dichroism (CD) spectroscopy can confirm proper secondary structure formation, particularly the transmembrane α-helical regions that are critical for function .

For researchers specifically interested in the conserved motifs, site-directed mutagenesis of key residues (such as the WR motif identified in human and yeast derlins) followed by functional assays can determine whether these motifs are also essential for maize Derlin-1.2 function .

What experimental approaches can be used to study Derlin-1.2 function in planta?

To investigate the physiological role of Derlin-1.2 in maize, several in planta approaches are available:

  • CRISPR/Cas9-mediated gene editing: Creating knockout or knockdown lines of Derlin-1.2 in maize to study phenotypic effects, especially under stress conditions that might induce ER stress.

  • Transient expression systems: Using Agrobacterium-mediated infiltration for transient expression of wild-type or mutant Derlin-1.2 fused to fluorescent tags in Nicotiana benthamiana leaves to study localization and potential stress responses .

  • Stable transformation: Generating transgenic maize lines overexpressing Derlin-1.2 or expressing tagged versions for co-immunoprecipitation studies to identify interaction partners in vivo.

  • RNA interference (RNAi): Silencing Derlin-1.2 expression and analyzing the impact on ERAD substrate accumulation and stress responses.

  • Transcriptome analysis: Comparing gene expression profiles between wild-type and Derlin-1.2-modified plants under normal and stress conditions using RNA-seq or microarray approaches .

These approaches can be particularly informative when studying plants under conditions that induce ER stress, such as heat shock, drought, or treatment with ER stress-inducing chemicals like tunicamycin or DTT.

How do maize Derlin-1.2 variants compare across different Zea mays cultivars and related species?

Comparative analysis of Derlin-1.2 across different maize cultivars and related species can provide insights into evolutionary conservation and functional importance:

  • Sequence conservation: Analysis of Derlin-1.2 sequences from different maize lines shows high conservation of key functional domains, particularly the transmembrane regions and the WR motif, suggesting strong selective pressure to maintain ERAD function.

  • Expression variation: Transcriptome data indicates that Derlin-1.2 expression levels can vary between different maize cultivars, potentially correlating with stress tolerance capabilities. Expression profiling in different tissues and developmental stages reveals tissue-specific regulation patterns .

  • Introgression analysis: Studies examining genetic exchange between maize and its wild relative teosinte (Zea mays ssp. mexicana) indicate selective sorting of introgressed ancestry, which may include ERAD components like Derlin-1.2 that contribute to environmental adaptation .

The evolutionary conservation of Derlin-1.2 and related ERAD components across Zea species provides evidence for their fundamental importance in cellular homeostasis and stress responses.

How does Derlin-1.2 interact with other components of the ERAD machinery in maize?

Based on homology with better-characterized systems, Zea mays Derlin-1.2 likely participates in a complex network of protein-protein interactions within the ERAD pathway:

  • Predicted interaction partners: Based on studies in yeast and human systems, maize Derlin-1.2 likely interacts with:

    • E3 ubiquitin ligases (potentially homologs of HRD1)

    • AAA-ATPase complex (CDC48/p97 homologs)

    • Other ERAD components such as SEL1L homologs

  • Identification methods: To experimentally identify Derlin-1.2 interaction partners, researchers can employ:

    • Co-immunoprecipitation with epitope-tagged Derlin-1.2

    • Proximity labeling approaches (BioID or APEX)

    • Yeast two-hybrid screening

    • Mass spectrometry-based interactome analysis

  • Functional complexes: The table below summarizes predicted protein complexes involving Derlin-1.2 based on knowledge from other systems:

Complex TypePredicted ComponentsFunction
RetrotranslocationDerlin-1.2, Hrd1 homolog, Sel1L homologChannel formation for ERAD substrate extraction
UbiquitinationDerlin-1.2, E3 ligases, E2 conjugating enzymesSubstrate ubiquitination for degradation
ExtractionDerlin-1.2, CDC48/p97 homolog, UFD1, NPL4ATP-dependent extraction of ERAD substrates

Mutagenesis studies of key residues, particularly in the L1 loop and transmembrane domain 2 (TM2), would be valuable for determining which regions of maize Derlin-1.2 are critical for interactions with specific partners, based on the importance of these regions in human Derlin-1 .

What are common challenges in working with recombinant Derlin-1.2 and how can they be overcome?

Researchers working with Derlin-1.2 typically encounter several technical challenges:

  • Low expression yields: As a transmembrane protein, Derlin-1.2 often expresses poorly in heterologous systems.

    • Solution: Optimize codon usage for the expression host, use specialized strains like C41/C43 for E. coli, and reduce expression temperature to 16-20°C.

  • Protein aggregation: Improper folding often leads to inclusion body formation.

    • Solution: Use mild detergents for extraction, consider fusion tags that enhance solubility (such as MBP or SUMO), and experiment with different detergent types and concentrations for solubilization.

  • Loss of function during purification: Native conformation may be disrupted during extraction and purification.

    • Solution: Employ gentle solubilization with non-ionic detergents, consider nanodiscs or amphipols for maintaining native-like membrane environments, and minimize exposure to harsh conditions.

  • Difficulties in functional assays: Assessing channel or retrotranslocation activity is technically challenging.

    • Solution: Develop robust reconstitution systems, use fluorescently labeled ERAD substrates, and establish reliable readouts for protein-protein interactions.

  • Inconsistent antibody recognition: Commercial antibodies may show variable specificity.

    • Solution: Generate custom antibodies against specific epitopes of Zea mays Derlin-1.2, validate with multiple techniques including western blotting of plant extracts and immunofluorescence.

How can researchers validate that recombinant Derlin-1.2 maintains its native conformation and activity?

Validating proper folding and function of recombinant Derlin-1.2 requires multiple complementary approaches:

  • Structural validation:

    • Circular dichroism (CD) spectroscopy to confirm proper secondary structure content

    • Limited proteolysis to assess conformational integrity

    • Thermal shift assays to determine protein stability

    • Size-exclusion chromatography to verify monodispersity

  • Functional validation:

    • Reconstitution into liposomes or nanodiscs

    • Binding assays with known interaction partners (e.g., Cdc48/p97 homologs)

    • Comparison with native Derlin-1.2 extracted from maize when possible

  • In vivo complementation:

    • Expression of recombinant Derlin-1.2 in derlin-deficient systems (yeast dfm1Δ mutants) to test functional complementation

    • Phenotypic rescue in plant systems with reduced Derlin-1.2 expression

When validating recombinant protein activity, it's important to include appropriate controls such as denatured protein samples and mutants of key functional residues (e.g., in the WR motif) known to abolish function in related derlins .

What emerging technologies might advance our understanding of Derlin-1.2 function?

Several cutting-edge approaches hold promise for deeper insights into Derlin-1.2 biology:

  • Cryo-electron microscopy: The recent advances in cryo-EM for membrane proteins could enable structural determination of Derlin-1.2 alone or in complex with other ERAD components, providing mechanistic insights into its retrotranslocation function.

  • Single-molecule techniques: FRET-based approaches to monitor conformational changes during substrate translocation could reveal dynamic aspects of Derlin-1.2 function.

  • Artificial intelligence approaches: AlphaFold2 and related tools can predict protein structures and interactions, potentially identifying novel features of Derlin-1.2 function and regulation.

  • Genome editing in crop species: CRISPR/Cas9-mediated precise genome editing of Derlin-1.2 in commercially relevant maize varieties to investigate its contribution to stress tolerance under field conditions.

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data from wild-type and Derlin-1.2-modified plants to build comprehensive models of ERAD function in crop physiology.

  • Optogenetic tools: Development of light-responsive Derlin-1.2 variants to control ERAD activity with temporal and spatial precision, allowing detailed dissection of its function in specific tissues or developmental stages.

These technologies, especially when combined, have the potential to transform our understanding of how ERAD components like Derlin-1.2 contribute to plant cellular homeostasis and stress responses.

How might research on Derlin-1.2 contribute to broader understanding of plant stress adaptation mechanisms?

Research on Derlin-1.2 has significant implications for understanding fundamental aspects of plant biology:

  • ER stress response networks: Characterizing how Derlin-1.2 functions within the broader context of ER stress responses can reveal coordinated cellular adaptations to environmental challenges.

  • Protein quality control evolution: Comparative studies of Derlin-1.2 across plant species can illuminate how ERAD machinery has evolved to accommodate species-specific proteomes and environmental niches.

  • Crop improvement applications: Understanding the role of Derlin-1.2 in stress tolerance could inform strategies for developing more resilient crop varieties through either:

    • Traditional breeding approaches that select for optimal Derlin-1.2 variants

    • Biotechnological interventions to modulate ERAD capacity

  • Systems biology models: Integration of Derlin-1.2 function into computational models of cellular stress responses can improve predictive understanding of how plants respond to changing environments.

By investigating fundamental mechanisms of protein quality control through Derlin-1.2, researchers can contribute to both basic plant science and potential applications in agriculture, especially as climate change intensifies the need for stress-tolerant crops.

What are the optimal conditions for storing and handling recombinant Derlin-1.2?

Proper storage and handling are critical for maintaining Derlin-1.2 stability and functionality:

  • Short-term storage (1-2 weeks):

    • Store at 4°C in buffer containing appropriate detergent at 2× CMC

    • Include reducing agent (1-5 mM DTT or 2-10 mM β-mercaptoethanol) to prevent disulfide formation

    • Add protease inhibitors to prevent degradation

  • Long-term storage:

    • Store at -20°C or preferably -80°C in small aliquots to avoid repeated freeze-thaw cycles

    • Include 10-25% glycerol as cryoprotectant

    • Flash-freeze in liquid nitrogen before transferring to -80°C storage

  • Buffer considerations:

    • pH: Typically 7.5-8.0 (20-50 mM Tris or HEPES buffer)

    • Salt: 150-300 mM NaCl to maintain solubility

    • Detergent: Critical to maintain at concentration above CMC (commonly DDM at 0.02-0.05%)

  • Shelf life:

    • Liquid form: approximately 6 months at -20°C/-80°C

    • Lyophilized form: approximately 12 months at -20°C/-80°C

  • Quality control:

    • Periodically verify integrity by SDS-PAGE

    • Check activity using established functional assays

    • Monitor aggregation by dynamic light scattering if equipment is available

Repeated freezing and thawing should be strictly avoided as it significantly reduces protein stability and activity .

How can recombinant Derlin-1.2 be employed in protein-protein interaction studies?

Recombinant Derlin-1.2 provides a valuable tool for dissecting the ERAD interactome in plants:

  • Pull-down assays:

    • His-tagged Derlin-1.2 can be immobilized on Ni-NTA resin

    • Incubate with plant lysates or recombinant potential partners

    • Analyze bound proteins by western blotting or mass spectrometry

    • Include appropriate controls (mutated Derlin-1.2, unrelated His-tagged protein)

  • Surface Plasmon Resonance (SPR):

    • Immobilize Derlin-1.2 on a sensor chip in detergent-containing buffer

    • Flow potential interaction partners over the surface

    • Measure association and dissociation kinetics

    • Calculate binding affinities (KD values)

  • Crosslinking approaches:

    • Use membrane-permeable crosslinkers to capture transient interactions

    • Apply to reconstituted systems or in planta with tagged Derlin-1.2

    • Identify crosslinked partners by mass spectrometry

  • Fluorescence-based approaches:

    • Fluorescence resonance energy transfer (FRET) between fluorescently labeled Derlin-1.2 and potential partners

    • Microscale thermophoresis (MST) to quantify binding interactions

    • Fluorescence correlation spectroscopy (FCS) to analyze dynamics

  • Reconstituted systems:

    • Co-reconstitute Derlin-1.2 with potential partners in liposomes

    • Assess functional consequences (e.g., ATP hydrolysis for Cdc48/p97 interaction)

    • Image using electron microscopy to visualize complexes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.