Recombinant Zea mays NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ND3; NAD3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
ND3
Target Protein Sequence
MLEFAPICIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILFIGSLYEWKRGALDWE
Uniprot No.

Target Background

Function

A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's considered part of the minimal assembly essential for catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.

Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What expression systems are commonly used to produce recombinant Zea mays ND3 protein?

Recombinant Zea mays ND3 protein is typically produced using prokaryotic expression systems, with Escherichia coli being the most common host. The methodological approach involves:

  • Gene synthesis or cloning: The ND3 coding sequence (CDS) is either synthetically produced or cloned from maize mitochondrial DNA.

  • Vector construction: The CDS is inserted into an expression vector containing:

    • A strong promoter (commonly T7)

    • An affinity tag (typically His-tag at N-terminus)

    • Selection markers

    • Origin of replication

  • Expression conditions: Optimal expression is achieved through:

    • IPTG induction (typically 0.5-1 mM)

    • Growth at lower temperatures (16-25°C) to enhance proper folding

    • Expression monitoring via SDS-PAGE

  • Purification protocol: The protein is purified using:

    • Immobilized metal affinity chromatography (IMAC)

    • Buffer optimization containing 6% Trehalose at pH 8.0

    • Lyophilization to create a stable powder form

For experimental applications requiring larger quantities, scaling up bacterial cultures to 1-5L fermentation systems may be necessary to achieve sufficient protein yields.

How should recombinant Zea mays ND3 be stored and reconstituted for experimental use?

Proper storage and reconstitution of recombinant Zea mays ND3 protein is critical for maintaining its activity and structural integrity. The recommended protocol includes:

Storage conditions:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Long-term storage requires 50% glycerol (final concentration) and storage at -20°C/-80°C

Reconstitution protocol:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol (5-50% final concentration) for long-term storage

  • Aliquot into single-use volumes to prevent freeze-thaw damage

Buffer compatibility:
The protein is typically provided in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which maintains protein stability during storage and reconstitution .

Repeated freeze-thaw cycles should be strictly avoided as they significantly reduce protein activity and increase aggregation.

What experimental approaches can be used to study the function of recombinant Zea mays ND3 in Complex I assembly and activity?

Investigating the role of recombinant Zea mays ND3 in Complex I assembly and activity requires multiple complementary approaches:

In vitro reconstitution studies:

  • Liposome reconstitution assay: Incorporate purified recombinant ND3 with other Complex I components into liposomes to assess minimal functional units

  • Electron transfer activity: Measure NADH:ubiquinone oxidoreductase activity using spectrophotometric assays tracking NADH oxidation at 340 nm

  • Proton pumping assays: Monitor proton translocation using pH-sensitive dyes or electrodes

Structural analysis:

  • Cryo-EM analysis of reconstituted complexes with and without ND3

  • Crosslinking mass spectrometry to identify interaction partners

  • Hydrogen-deuterium exchange mass spectrometry to assess conformational changes

Functional complementation:

  • Express recombinant ND3 in ND3-deficient plant mitochondria

  • Measure restoration of electron transport chain activity

  • Analyze Complex I assembly via Blue Native PAGE followed by western blotting

Comparative studies:
Compare activities of wild-type ND3 versus site-directed mutants to identify critical residues for function and assembly .

How can site-specific recombinase systems be utilized with Zea mays ND3 for genetic engineering applications?

Site-specific recombinase systems offer precise genetic manipulation tools for studying ND3 function in maize. These approaches enable:

Conditional expression systems:

  • Utilize recombinase-activatable promoters to control ND3 expression

  • Employ recombinase-mediated cassette exchange (RMCE) to introduce variants

  • Implement inducible recombinase systems for temporal control

Available recombinase systems in maize:
Various recombinase systems have been validated in maize and can be applied to ND3 studies:

RecombinaseRecognition SitesApplication for ND3 Studies
CreloxPConditional knockout/knockin
FLPeFRTMarker removal after transformation
RRSTissue-specific expression
phiC31 IntegraseattP/attBTargeted integration
phiC31 ExcisionaseattL/attRRemoval of integrated constructs

Methodology for implementation:

  • Design constructs with recombinase recognition sites flanking ND3 or regulatory elements

  • Transform maize with the construct using Agrobacterium-mediated transformation

  • Cross with recombinase-expressing lines or introduce recombinase transiently

  • Screen for recombination events using reporter genes (e.g., DsRed)

  • Validate recombination by PCR and sequencing

This approach allows precise manipulation of ND3 expression to study its role in mitochondrial function, plant growth, and stress responses.

What approaches can be used to investigate interactions between recombinant Zea mays ND3 and other mitochondrial proteins?

Investigating protein-protein interactions involving recombinant Zea mays ND3 requires specialized techniques due to its hydrophobic nature and membrane association:

In vitro interaction studies:

  • Co-immunoprecipitation (Co-IP):

    • Use His-tagged ND3 as bait with mitochondrial extracts

    • Analyze interacting partners by mass spectrometry

    • Confirm specific interactions with western blotting

  • Membrane-based yeast two-hybrid (MYTH):

    • Split-ubiquitin system for membrane protein interactions

    • Express ND3 fused to C-terminus of ubiquitin

    • Screen against mitochondrial protein library

  • Surface plasmon resonance (SPR):

    • Immobilize ND3 on sensor chip

    • Measure binding kinetics with purified interaction candidates

    • Determine association and dissociation constants

In vivo approaches:

  • Bimolecular fluorescence complementation (BiFC):

    • Fuse ND3 and potential interactors to split fluorescent protein fragments

    • Transiently express in maize protoplasts

    • Visualize interactions through reconstituted fluorescence

  • Proximity-dependent biotin identification (BioID):

    • Fuse ND3 to biotin ligase

    • Express in maize mitochondria

    • Identify neighboring proteins through streptavidin pulldown and MS analysis

Structural approaches:

  • Crosslinking coupled with mass spectrometry:

    • Use membrane-permeable crosslinkers

    • Identify crosslinked peptides by MS/MS

    • Map interaction interfaces at amino acid resolution

These methodologies provide complementary data to build a comprehensive interaction network for ND3 in the mitochondrial respiratory chain.

How can researchers investigate the role of Zea mays ND3 in stress response mechanisms using recombinant protein?

Investigating ND3's role in stress response requires multifaceted approaches using recombinant protein:

In vitro stress simulation studies:

  • Oxidative stress assessment:

    • Expose recombinant ND3 to ROS-generating systems

    • Analyze modifications via mass spectrometry

    • Measure functional changes in electron transport activity

    • Compare wild-type vs. site-directed mutants at conserved residues

  • Temperature sensitivity analysis:

    • Perform thermal stability assays (differential scanning fluorimetry)

    • Correlate structural changes with functional alterations

    • Identify temperature-sensitive domains

Ex vivo mitochondrial studies:

  • Reconstitution experiments:

    • Incorporate recombinant ND3 into ND3-depleted mitochondria

    • Expose to stressors (heat, salt, drought mimetics)

    • Measure respiratory parameters:

      • Oxygen consumption rates

      • Membrane potential

      • ROS production

Comparative studies across Zea species:
Research has shown that wild Zea species such as Zea luxurians contain greater genetic diversity than domesticated maize lines, potentially harboring stress-resistant variants of mitochondrial proteins .

Stress ConditionParameters to MeasureExpected ND3 Response
Heat stressActivity at 25-45°CActivity decline above specific threshold
Oxidative stressH₂O₂/O₂⁻ exposurePost-translational modifications
pH stressActivity at pH 6.0-8.5Altered proton pumping efficiency
Salt stressActivity with 0-200mM NaClConformational changes

These experiments can reveal how ND3 contributes to mitochondrial adaptations during environmental stress .

What techniques can be employed to study the structure-function relationship of recombinant Zea mays ND3?

Understanding structure-function relationships of recombinant Zea mays ND3 requires integrated biophysical and biochemical approaches:

Structural analysis techniques:

  • Membrane protein crystallization:

    • Lipidic cubic phase crystallization

    • Bicelle crystallization

    • Detergent screening for optimal solubilization

  • Cryo-electron microscopy:

    • Single-particle analysis of purified Complex I

    • Subtomogram averaging of membrane-embedded complexes

    • Identification of ND3 position and conformation

  • NMR spectroscopy:

    • Solution NMR of isolated transmembrane domains

    • Solid-state NMR for full-length protein

    • Chemical shift analysis for secondary structure determination

Functional mapping approaches:

  • Alanine scanning mutagenesis:

    • Systematic replacement of conserved residues

    • Functional assays for each mutant:

      • NADH oxidation rates

      • Ubiquinone reduction activity

      • Proton pumping efficiency

  • Domain swapping experiments:

    • Exchange domains between ND3 orthologs

    • Identify regions responsible for specific activities

    • Correlate with evolutionary conservation

Computational methods:

  • Molecular dynamics simulations:

    • Model ND3 in lipid bilayer environment

    • Simulate conformational changes during catalytic cycle

    • Predict water/proton channels

  • Evolutionary analysis:

    • Compare ND3 sequences across plant species

    • Identify conserved motifs under selective pressure

    • Correlate with known functional domains

These approaches together can reveal how specific structural elements of ND3 contribute to its function in the respiratory chain .

How can recombinant Zea mays ND3 be integrated into studies of maize mitochondrial genome editing?

Utilizing recombinant ND3 in mitochondrial genome editing studies requires specialized approaches due to the unique challenges of organellar transformation:

Functional validation of edited mitochondrial genes:

  • Complementation assays:

    • Create mitochondrial mutants using TALEN or base editors

    • Express recombinant ND3 variants to rescue phenotypes

    • Measure respiratory function restoration

  • Import studies:

    • Design nuclear-encoded ND3 with mitochondrial targeting signals

    • Assess import efficiency into isolated mitochondria

    • Evaluate assembly into Complex I

Genome editing strategies:

  • Mitochondria-targeted nucleases:

    • Target mitochondrial ND3 using mitoTALENs

    • Validate edits by sequencing

    • Use recombinant protein to validate function of edited variants

  • RNA-based approaches:

    • Target mitochondrial ND3 transcript with PPR proteins

    • Induce specific RNA editing events

    • Compare activity of edited variants using recombinant proteins

Experimental workflow:

StepMethodologyKey Parameters
1. DesignIdentify target sites in ND3Conservation analysis across Zea species
2. EditDeliver editing tools to mitochondriaTargeting efficiency, specificity
3. ValidateSequence mitochondrial DNAEdit frequency, off-targets
4. ExpressProduce recombinant edited variantsProtein expression levels, solubility
5. Functional testingCompare wild-type vs edited ND3Complex I activity, ROS production

These approaches allow researchers to study the effects of specific genetic variations in ND3 on mitochondrial function and plant performance .

What role might ND3 play in maize breeding programs focused on stress tolerance and yield improvement?

Understanding ND3's role in metabolism provides potential targets for breeding programs focused on stress tolerance and yield improvement:

Mitochondrial efficiency and crop performance:
Research has established strong correlations between mitochondrial function and crop productivity. ND3, as a component of Complex I, influences:

  • Energy production efficiency

  • Electron transport chain coupling

  • ROS generation under stress conditions

  • Plant growth and development under suboptimal conditions

Screening approaches:

  • Natural variation analysis:

    • Survey ND3 sequence diversity across maize germplasm

    • Correlate specific haplotypes with stress tolerance

    • Identify superior alleles from wild relatives like Zea luxurians

  • Functional markers development:

    • Design markers for ND3 variants associated with improved performance

    • Implement in marker-assisted selection programs

    • Validate through near-isogenic line development

Integration with breeding data:
Studies with diverse maize germplasm have shown that:

  • Variation in mitochondrial genes can affect yield under stress conditions

  • Wild maize relatives like Zea luxurians contain greater genetic diversity than domesticated lines

  • Teosinte lines show differential responses to weed pressure at both morphological and transcriptomic levels

TraitPotential ND3 ContributionBreeding Approach
Drought toleranceMaintenance of ATP productionSelect efficient ND3 variants
Heat toleranceReduced ROS productionIdentify thermostable ND3 alleles
Nutrient use efficiencyOptimized energy metabolismFocus on variants with improved coupling
Yield stabilityConsistent mitochondrial functionCombine optimal ND3 with nuclear genes

By incorporating ND3 variants into breeding programs, researchers can potentially develop maize varieties with improved stress tolerance, especially under conditions where mitochondrial function becomes limiting .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.