Recombinant Zea mays NADH-ubiquinone oxidoreductase chain 5 (ND5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
ND5; NAD5; NADH-ubiquinone oxidoreductase chain 5; NADH dehydrogenase subunit 5; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
ND5
Target Protein Sequence
NFWANSPFVLPKNEILAESEFAAPTITKLIPILFSTSGASLAYNVNLVADQFQRAFQTST FCNRLYSFFNKRWFFDQVLNDFLVRSFLRFGYSVSFEALDKGAIEILGPYGISYTFRRLA ERISQLQSGSVYHYAFAMLLGSTPFVTFSRMWDSLSSWVDSRSSFILLVSSFIINKSSQE
Uniprot No.

Target Background

Function
Recombinant *Zea mays* NADH-ubiquinone oxidoreductase chain 5 (ND5) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be its immediate electron acceptor.
Protein Families
Complex I subunit 5 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of NADH-ubiquinone oxidoreductase chain 5 (ND5) in Zea mays?

NADH-ubiquinone oxidoreductase chain 5 (ND5) is a crucial subunit of Complex I (NADH:ubiquinone oxidoreductase) in the mitochondrial electron transport chain of Zea mays. Like its counterparts in other species, maize ND5 plays an essential role in energy transduction, specifically in the transfer of electrons from NADH to ubiquinone while simultaneously pumping protons across the inner mitochondrial membrane. This process contributes to establishing the proton gradient necessary for ATP synthesis.

Complex I contains multiple subunits along with non-covalently bound flavin mononucleotide and iron-sulfur clusters that facilitate electron transfer. In bovine Complex I, which serves as a well-studied model, the enzyme contains 45 different subunits . The ND5 subunit is specifically involved in proton translocation and is encoded by the mitochondrial genome in maize.

What are the optimal conditions for expressing recombinant Zea mays ND5?

Expressing recombinant Zea mays ND5 presents significant challenges due to its hydrophobic nature and mitochondrial origin. The optimal expression system typically involves:

  • Expression vector selection: Vectors with strong promoters suitable for membrane proteins, such as pET series vectors modified with additional chaperone co-expression capabilities.

  • Host selection: E. coli strains C41(DE3) or C43(DE3) are preferred as they are engineered specifically for membrane protein expression. For more native-like post-translational modifications, yeast systems like Pichia pastoris may be considered.

  • Growth conditions:

    • Temperature: 16-20°C after induction

    • Induction: 0.1-0.5 mM IPTG (when using bacterial systems)

    • Growth media: Enriched media containing supplemental iron sources to support iron-sulfur cluster formation

  • Fusion tags: N-terminal tags such as MBP (maltose-binding protein) or SUMO can improve solubility, though care must be taken as they may affect the native structure of membrane-spanning regions.

When evaluating expression, it's crucial to compare the activity of the recombinant protein with native Complex I preparations, as recombinant ND5 may exhibit different behaviors in ubiquinone reduction assays compared to the native complex .

What are the most effective methods for isolating and purifying recombinant Zea mays ND5?

The isolation and purification of recombinant Zea mays ND5 require specialized techniques due to its hydrophobic nature:

  • Cell lysis and membrane fraction isolation:

    • Gentle lysis using mild detergents or mechanical disruption

    • Differential centrifugation to isolate membrane fractions

    • Careful separation of mitochondrial membrane fractions from other cellular components

  • Solubilization:

    • Use of mild detergents such as n-dodecyl-β-D-maltoside (DDM), digitonin, or CHAPS

    • Critical detergent:protein ratio must be empirically determined

    • Solubilization buffer typically containing 20 mM Tris-HCl (pH 7.2-7.5), 150 mM NaCl, 10% glycerol, and 1-2% detergent

  • Purification strategy:

    • Affinity chromatography using the fusion tag

    • Ion exchange chromatography

    • Size exclusion chromatography for final polishing

    • All steps performed at 4°C with detergent present in all buffers

  • Quality assessment:

    • SDS-PAGE and western blotting

    • Mass spectrometry verification

    • Activity assays compared against native complex preparations

The purification process must balance the need for purity with maintaining protein stability and activity, as complete removal of lipids and detergents may lead to protein aggregation or activity loss.

How can I assess the functional activity of recombinant Zea mays ND5?

Assessing the functional activity of recombinant Zea mays ND5 requires both direct and indirect approaches:

  • NADH:ubiquinone oxidoreductase activity assays:

    • Spectrophotometric monitoring of NADH oxidation at 340 nm

    • Measurement of ubiquinone reduction using various ubiquinone analogs

    • Comparison of activity with and without Complex I inhibitors (rotenone, piericidin A)

  • Site-specific activity determination:

    • Distinguish between hydrophobic (physiological) and hydrophilic sites of ubiquinone reduction

    • Test with different ubiquinones: DQ, Q₁, Q₀, and idebenone

    • Measure inhibitor sensitivity to determine reaction mechanism

The following table shows typical relative inhibitor sensitivity patterns when testing different ubiquinones with recombinant Complex I components:

Ubiquinone TypeInhibitor Sensitivity (%)Activity at Hydrophobic SiteActivity at Hydrophilic Site
DQ~95% (rotenone)HighLow
Q₁~90% (piericidin A)HighModerate
Q₀~50% (rotenone)ModerateHigh
Idebenone~60% (piericidin A)ModerateModerate
  • Reconstitution experiments:

    • Incorporation into liposomes to assess proton pumping activity

    • Measurement of membrane potential using voltage-sensitive dyes

    • Electron paramagnetic resonance (EPR) to detect semiquinone intermediates

When interpreting results, note that recombinant ND5 may not perfectly recapitulate native Complex I behavior, particularly regarding the balance between hydrophobic and hydrophilic site activities .

What are the best recombination strategies for creating Zea mays lines with modified ND5?

Creating Zea mays lines with modified ND5 presents unique challenges due to ND5's mitochondrial localization. Several strategies can be employed:

  • Breeding-based approaches:

    • Identify natural variants through diverse germplasm screening

    • Use of cytoplasmic male sterility (CMS) lines that may contain ND5 variations

    • Selection of restorer lines that can compensate for ND5 modifications

  • Population development strategies:

    • Different population types offer varying recombination characteristics:

      • Doubled haploid (DH): Average 16 recombination events per line

      • Recombinant inbred lines (RIL): Average 41 recombination events per line

      • Intermated B73×Mo17 (IBM): Average 72 recombination events per line

      • Multi-parent advanced generation inter-cross (MAGIC): Average 86 recombination events per line

  • Marker-assisted selection:

    • Use high-density SNP markers like MaizeSNP50 BeadChip for tracking ND5 variants

    • Consider recombination frequency differences across the genome (varying from 0-42.3 cM/Mb depending on population type)

    • Design breeding schemes accounting for recombination characteristics of different population types

  • Advanced techniques:

    • Mitochondrial transformation (though technically challenging in plants)

    • Nucleus-encoded synthetic versions with mitochondrial targeting sequences

    • TALEN or CRISPR-based approaches targeting nuclear factors that interact with ND5

The choice of population type should consider the resolution needed for your specific research questions, as demonstrated by the significant differences in recombinant chromosomal segment lengths: DH (84.8 Mb), RIL (47.3 Mb), IBM (29.2 Mb), and MAGIC (20.4 Mb) .

How can recombination patterns affect studies of Zea mays ND5 variants?

Recombination patterns significantly impact studies of Zea mays ND5 variants by affecting mapping resolution, population structure, and variant distribution:

  • Recombination variation across populations:

    • Different maize population types exhibit varying numbers of recombination events per line (DH: 16, RIL: 41, IBM: 72, MAGIC: 86)

    • Recombination frequency varies across genomic regions and population types [DH (0–12.7 cM/Mb), RIL (0–15.5 cM/Mb), IBM (0–24.1 cM/Mb), MAGIC (0–42.3 cM/Mb)]

  • Mapping resolution considerations:

    • Recombination bin size varies inversely with population size and recombination frequency

    • Estimation of theoretical recombination bin number can be calculated as:
      Y = 1 + a × X
      Where Y is the number of recombination bins, a is the mean number of recombination events, and X is the number of lines

  • Mitochondrial inheritance factors:

    • Maternal inheritance of mitochondria creates unique recombination considerations

    • Linkage of ND5 with other mitochondrial genes requires special statistical approaches

    • Nuclear-mitochondrial interactions complicate mapping efforts

  • Practical recommendations:

    • For fine mapping of ND5-related traits, MAGIC populations offer the highest recombination frequency

    • For initial QTL discovery, RIL populations may provide a better balance of recombination and genetic stability

    • Consider using multiple population types to validate findings across different genetic backgrounds

What techniques are most effective for studying protein-protein interactions involving recombinant Zea mays ND5?

Several techniques are particularly useful for studying protein-protein interactions involving recombinant Zea mays ND5:

  • Cross-linking mass spectrometry (XL-MS):

    • Chemical cross-linkers with varying spacer arm lengths can capture interactions

    • MS/MS analysis identifies cross-linked peptides, revealing interaction sites

    • Data analysis requires specialized software (pLink, xQuest) to identify cross-linked peptides

  • Co-immunoprecipitation with specifically designed controls:

    • Requires antibodies against ND5 or fusion tag

    • Membrane solubilization conditions must be optimized to maintain interactions

    • MS analysis of co-precipitated proteins identifies interaction partners

    • Controls must include non-specific antibodies and competitive elution tests

  • Proximity labeling approaches:

    • Fusion of BioID or APEX2 to ND5 for proximity-dependent labeling

    • Biotinylated proteins can be isolated using streptavidin pulldown

    • Special considerations for mitochondrial targeting of the fusion protein

  • Split reporter systems:

    • Split GFP, split luciferase, or bimolecular fluorescence complementation (BiFC)

    • Requires careful design of fusion constructs to avoid disrupting transmembrane regions

    • Controls must address potential artifacts due to overexpression

  • Surface plasmon resonance (SPR) or microscale thermophoresis (MST):

    • For quantitative measurement of binding affinities with purified components

    • Requires detergent optimization to maintain ND5 stability

    • Can determine binding kinetics parameters (kon, koff, KD)

When interpreting results, remember that the hydrophobic nature of ND5 makes distinguishing specific from non-specific interactions challenging. Validation across multiple techniques is strongly recommended.

How do the ubiquinone reduction mechanisms of recombinant Zea mays ND5 compare to other systems?

Understanding the ubiquinone reduction mechanisms of recombinant Zea mays ND5 requires comparative analysis with other systems, particularly considering the dual-site model established for Complex I:

  • Two distinct ubiquinone reduction sites:

    • Hydrophobic site: Physiological, proton-translocating, inhibitor-sensitive

    • Hydrophilic site: Non-proton-translocating, inhibitor-insensitive

  • Reactivity patterns with different ubiquinones:

    • The reactivity at both sites is influenced by ubiquinone hydrophobicity

    • Bovine Complex I studies show that DQ and Q₁ have higher activity at the hydrophobic site

    • Q₀ and idebenone show greater relative activity at the hydrophilic site

    • Phospholipid presence significantly affects the reaction rates, especially for DQ and Q₁

  • Species-specific variations:

    • Plant Complex I contains additional subunits not found in mammalian systems

    • Maize ND5 may exhibit different ubiquinone preferences compared to bovine systems

    • The balance between hydrophobic and hydrophilic site activity may differ in plant systems

  • Inhibitor sensitivity patterns:

    • Rotenone and piericidin A inhibit only the hydrophobic site reaction

    • Inhibition patterns vary by quinone type and experimental conditions

    • The following table summarizes typical inhibition patterns from bovine studies that may inform maize research:

Ubiquinone TypeInhibitor Sensitivity with PhospholipidsInhibitor Sensitivity without PhospholipidsPrimary Reactive Site
DQ~95%DecreasedHydrophobic
Q₁~90%DecreasedHydrophobic
Q₀~50%DecreasedHydrophilic
Idebenone~60%DecreasedBoth
  • Mechanism considerations for maize ND5:

    • The flavin site in Complex I may catalyze redox cycling reactions with various compounds

    • Plant-specific features may modify electron transfer pathways

    • Semiquinone intermediates may have different stabilities in plant vs. mammalian systems

When characterizing recombinant Zea mays ND5, researchers should conduct parallel experiments with both plant and mammalian Complex I to identify conserved and divergent mechanistic features.

What analytical methods best characterize the electron transfer properties of recombinant Zea mays ND5?

Characterizing the electron transfer properties of recombinant Zea mays ND5 requires specialized analytical approaches:

  • Steady-state kinetic measurements:

    • NADH oxidation rates measured spectrophotometrically at 340 nm

    • Ubiquinone reduction monitoring using ubiquinone analogs with different hydrophobicities

    • Determination of kinetic parameters (Km, Vmax) for both substrates

    • Comparison of reaction rates with and without Complex I inhibitors

  • Pre-steady-state kinetics:

    • Stopped-flow spectroscopy to capture rapid electron transfer events

    • Monitoring flavin reduction/oxidation states via fluorescence

    • Temperature-dependent measurements to determine activation parameters

  • EPR spectroscopy:

    • Detection and characterization of iron-sulfur cluster reduction states

    • Identification of semiquinone radical intermediates

    • Low-temperature measurements (4-100K) for optimal signal resolution

    • Power saturation studies to distinguish different iron-sulfur clusters

  • Electrochemical methods:

    • Protein film voltammetry on modified electrodes

    • Determination of redox potentials for electron transfer components

    • Chronoamperometry to measure electron transfer rates

  • Reactive oxygen species (ROS) measurements:

    • Superoxide detection using chemiluminescent probes or EPR spin trapping

    • Hydrogen peroxide quantification using Amplex Red or similar assays

    • Assessment of the relationship between quinone structure and ROS production

    • Special attention to semiquinone stability and redox cycling reactions

When interpreting results, it's important to consider that recombinant ND5 may not perfectly replicate the behavior of the complete Complex I. The ping-pong mechanism reported for the flavin site in bovine Complex I may serve as a reference model .

How does the recombination frequency of the ND5 genomic region compare to other maize genomic regions?

The recombination frequency in the genomic region containing ND5 must be considered within the broader context of maize genome recombination patterns:

  • Variation across the maize genome:

    • Recombination is not uniform across the maize genome

    • High recombination frequency mainly occurs in non-centromeric regions

    • Low recombination frequency is typically found in centromeric regions

  • Population-specific recombination patterns:

    • Different maize population types show distinct recombination frequency ranges:

      • DH populations: 0–12.7 cM/Mb

      • RIL populations: 0–15.5 cM/Mb

      • IBM populations: 0–24.1 cM/Mb

      • MAGIC populations: 0–42.3 cM/Mb

  • Mitochondrial genome considerations:

    • As ND5 is encoded in the mitochondrial genome, standard nuclear recombination metrics don't directly apply

    • Mitochondrial DNA undergoes different recombination processes than nuclear DNA

    • Plant mitochondrial genomes show unique recombination patterns including:

      • Homologous recombination between repeated sequences

      • Non-homologous end joining

      • Microhomology-mediated recombination

  • Implications for experimental design:

    • When studying nuclear factors affecting ND5 function, researchers should consider the recombination patterns of those nuclear regions

    • QTL mapping for traits associated with ND5 function may require specialized approaches

    • High-density marker coverage is needed in regions with lower recombination frequencies

When designing breeding or mapping experiments involving ND5-related traits, researchers should consider using MAGIC populations for highest mapping resolution or IBM populations for a balance of resolution and genetic stability .

What are the cutting-edge approaches for studying the role of ND5 in respiratory control and energy metabolism in Zea mays?

Several cutting-edge approaches are advancing our understanding of ND5's role in respiratory control and energy metabolism in Zea mays:

  • Single-molecule techniques:

    • Atomic Force Microscopy (AFM) to study conformational changes during catalysis

    • Single-molecule FRET to measure intramolecular distances and conformational dynamics

    • Optical tweezers to measure force generation during proton pumping

  • Cryo-electron microscopy (cryo-EM):

    • High-resolution structural determination of plant-specific Complex I features

    • Time-resolved cryo-EM to capture different catalytic states

    • Subtomogram averaging of in situ complexes in mitochondrial membranes

  • Advanced genetic approaches:

    • CRISPR-based mitochondrial base editors for precise ND5 modification

    • RNA-guided transcriptional modulators for controlled expression

    • Allotropic expression (nuclear expression with mitochondrial targeting) to bypass mitochondrial genetic constraints

  • Metabolic flux analysis:

    • ¹³C-labeling to track metabolic pathways affected by ND5 variants

    • Real-time monitoring of oxygen consumption and ATP production

    • Integration with computational models of plant energy metabolism

  • Systems biology integration:

    • Multi-omics approaches combining proteomics, metabolomics, and transcriptomics

    • Network analysis to identify ND5 interactions in respiratory regulation

    • Machine learning to predict consequences of ND5 modifications

  • In vivo imaging:

    • Genetically encoded sensors for ATP, NADH, and membrane potential

    • Two-photon microscopy for deep tissue imaging

    • Super-resolution microscopy to visualize Complex I distribution and dynamics

How should researchers address data inconsistencies when comparing recombinant Zea mays ND5 with native Complex I?

Addressing data inconsistencies between recombinant Zea mays ND5 and native Complex I requires systematic troubleshooting and careful interpretation:

  • Common sources of inconsistency:

    • Incomplete assembly of recombinant ND5 into functional complexes

    • Differences in lipid environment affecting protein conformation

    • Missing post-translational modifications in recombinant systems

    • Artifacts from fusion tags or expression system-specific factors

  • Systematic approach to resolving inconsistencies:

    • Develop a hierarchical testing protocol to isolate variables

    • Compare multiple parameters (not just activity but also inhibitor sensitivity, substrate affinity)

    • Test across multiple ubiquinone analogs to distinguish hydrophobic vs. hydrophilic site activities

    • Evaluate the impact of experimental conditions (detergents, phospholipids, temperature)

  • Recommended validation experiments:

    • Activity reconstitution experiments with purified components

    • Detailed inhibitor titration curves with multiple inhibitors

    • Cross-validation with different expression systems

    • Domain swapping between recombinant and native components

  • Statistical approaches for data reconciliation:

    • Apply Bayesian methods to integrate multiple data sources

    • Use bootstrapping to estimate confidence intervals

    • Develop structure-based models to predict experimental outcomes

    • Test consistency of parameters across different experimental designs

When interpreting data, remember that differences between recombinant and native systems may provide valuable insights into assembly processes and structure-function relationships rather than merely representing experimental artifacts.

What statistical approaches are most appropriate for analyzing Complex I activity data from recombinant Zea mays ND5?

Statistical analysis of Complex I activity data from recombinant Zea mays ND5 requires specialized approaches to address the unique characteristics of these experiments:

  • Experimental design considerations:

    • Nested design structure (multiple measurements from same preparation)

    • Batch effects from different protein preparations

    • Non-linear enzyme kinetics requiring specialized models

    • Multiple substrate and inhibitor interactions

  • Recommended statistical methods:

    • Mixed-effects models to account for nested data structure

    • Non-linear regression for enzyme kinetic parameters

    • Multivariate analysis to examine relationships between parameters

    • Bootstrapping for robust confidence interval estimation

    • Bayesian approaches for integrating prior knowledge with experimental data

  • Specific analytical approaches for different experiment types:

    • For inhibitor studies: IC₅₀ determination with appropriate binding models

    • For substrate kinetics: Model comparison (Michaelis-Menten vs. allosteric models)

    • For stability studies: Time-to-event analysis with appropriate censoring

    • For comparative studies: Formal equivalence testing rather than simple hypothesis testing

  • Reporting recommendations:

    • Always report both biological and technical replication details

    • Include raw data visualization alongside model fits

    • Report parameter estimates with confidence intervals

    • Include measures of goodness-of-fit for non-linear models

    • Clearly describe data transformations and outlier handling

  • Advanced considerations:

    • Develop mechanistic models incorporating both hydrophobic and hydrophilic sites

    • Account for cooperativity between multiple reaction steps

    • Consider Bayesian hierarchical models for integrating data across experiments

When analyzing data from different ubiquinone analogs, remember that their relative activities at the hydrophobic vs. hydrophilic sites vary significantly and require appropriate statistical models to distinguish true mechanistic differences from experimental variability .

How can recombinant Zea mays ND5 research contribute to improving stress tolerance in maize?

Recombinant Zea mays ND5 research has significant potential to contribute to stress tolerance improvement in maize through several avenues:

  • Understanding respiratory adaptation mechanisms:

    • Characterization of how ND5 variants affect electron transport under stress conditions

    • Identification of natural variants with enhanced stress tolerance

    • Determination of how alternative respiratory pathways interact with Complex I function

  • Engineering strategies based on ND5 insights:

    • Development of modified ND5 variants with optimized function under stress conditions

    • Design of precision breeding approaches targeting nuclear genes that interact with ND5

    • Creation of diagnostic tools to assess mitochondrial function in breeding populations

  • Linking ND5 function to specific stress responses:

    • Drought tolerance: Connection between respiratory efficiency and water use efficiency

    • Cold tolerance: Role of altered electron transport in membrane fluidity maintenance

    • Heat stress: Contribution of ND5 to preventing oxidative damage during temperature extremes

  • Predictive models for crop improvement:

    • Development of molecular markers associated with optimal ND5 function

    • Integration of ND5 variant data with broader genomic selection approaches

    • Computational models linking respiratory efficiency to whole-plant performance

  • Practical applications in breeding programs:

    • Use of recombination information to optimize breeding strategies:

      • MAGIC populations provide highest recombination frequency (86 events/line)

      • Recombination frequency varies across genomic regions

    • Selection of optimal germplasm based on ND5 variant characterization

    • Development of high-throughput phenotyping for mitochondrial function

When developing stress tolerance strategies, researchers should consider that the balance between activities at the hydrophobic (proton-pumping) and hydrophilic sites of Complex I may be crucial for stress adaptation, as this balance affects both energy production and reactive oxygen species generation .

What emerging technologies will advance our understanding of recombinant Zea mays ND5 function?

Several emerging technologies are poised to revolutionize our understanding of recombinant Zea mays ND5 function:

  • Advanced structural biology approaches:

    • Time-resolved cryo-EM to capture dynamic states during catalysis

    • Micro-electron diffraction (MicroED) for high-resolution structural details

    • Integrative structural biology combining multiple data sources (crosslinking-MS, NMR, SAXS)

    • High-throughput structural screening of ND5 variants

  • Single-cell and subcellular technologies:

    • Single-mitochondrion functional assays

    • Spatial transcriptomics to map nuclear responses to mitochondrial function

    • Nanoscale imaging of respiratory complexes in native membranes

    • Organelle-specific proteomics with enhanced sensitivity

  • Precision genome engineering:

    • Mitochondrial base editors with enhanced specificity

    • Bacterial cytoplasmic hybrid (cybrid) systems for rapid ND5 variant screening

    • Synthetic mitochondrial transplantation techniques

    • Inducible expression systems for temporal control of ND5 variants

  • Advanced computational approaches:

    • Molecular dynamics simulations of complete Complex I in membrane environments

    • Machine learning for predicting ND5 variant phenotypes

    • Systems biology models integrating mitochondrial and cellular metabolism

    • Quantum mechanics/molecular mechanics (QM/MM) calculations of electron transfer

  • Novel biochemical approaches:

    • Native mass spectrometry of intact respiratory supercomplexes

    • In-cell NMR to study ND5 dynamics in living cells

    • Novel fluorescent probes for real-time monitoring of electron transfer

    • Miniaturized respirometry for high-throughput phenotyping

When implementing these technologies, researchers should consider how they can address fundamental questions about the dual-site model of ubiquinone reduction, the mechanism of coupling electron transfer to proton pumping, and how plant-specific features of Complex I contribute to its function .

How might research on recombinant Zea mays ND5 inform our understanding of mitochondrial diseases in other organisms?

Research on recombinant Zea mays ND5 can provide valuable insights into mitochondrial diseases across species through comparative and translational approaches:

  • Conserved mechanistic insights:

    • Fundamental electron transfer mechanisms in Complex I are conserved across species

    • Understanding the structure-function relationships in plant ND5 can inform human disease models

    • Plant systems provide unique experimental advantages for studying basic mechanisms

  • Novel therapeutic strategies:

    • Alternative ubiquinone binding sites identified in plant systems may suggest new drug targets

    • Understanding the hydrophilic site of ubiquinone reduction could inform bypass therapies

    • Compounds like idebenone, which interact with both hydrophobic and hydrophilic sites, are already used in treating conditions like Friedreich's Ataxia

  • Oxidative stress mechanisms:

    • Plant ND5 research reveals how semiquinones produced at the flavin site initiate redox cycling with oxygen

    • These mechanisms are relevant to mitochondrial disease pathophysiology

    • Superoxide and hydrogen peroxide production pathways are conserved across species

  • Genetic suppressor mechanisms:

    • Plants have evolved unique mechanisms to compensate for Complex I dysfunction

    • Alternative NADH dehydrogenases and other bypass mechanisms in plants may suggest therapeutic approaches

    • Nuclear-mitochondrial communication pathways may reveal new intervention targets

  • Translational applications:

    • High-throughput screening platforms using plant systems

    • Developmental models for mitochondrial disease progression

    • Plant-derived compounds that modulate Complex I function

The understanding that hydrophilic ubiquinones are reduced by a ping-pong type mechanism at the flavin site, which generates reactive oxygen species, has direct implications for understanding mitochondrial disease mechanisms and developing treatments targeting specific electron transfer pathways .

What key resources are available for researchers working with recombinant Zea mays ND5?

Researchers working with recombinant Zea mays ND5 have access to several key resources that can accelerate their work:

  • Genetic resources:

    • Maize diversity panels with various population structures:

      • Doubled haploid (DH) populations with 16 recombination events per line (average)

      • Recombinant inbred line (RIL) populations with 41 recombination events per line

      • Intermated B73×Mo17 (IBM) populations with 72 recombination events per line

      • Multi-parent advanced generation inter-cross (MAGIC) populations with 86 recombination events per line

    • MaizeSNP50 BeadChip for high-density genotyping

    • Mitochondrial genome databases and annotation resources

  • Structural resources:

    • Homology models based on mammalian and bacterial Complex I structures

    • Predicted protein-protein interaction networks

    • Topology prediction tools specialized for membrane proteins

  • Functional analysis tools:

    • Protocols for distinguishing hydrophobic vs. hydrophilic site activities

    • Standardized assays for measuring ubiquinone reduction with various analogs

    • Methods for reconstitution of partial complexes

  • Data resources:

    • MaizeGDB for genomic and genetic information

    • Comparative mitochondrial genome databases

    • Expression atlases under various environmental conditions

    • Metabolic pathway databases integrating respiratory chain components

  • Collaboration networks:

    • International maize mitochondrial research consortia

    • Plant respiratory chain research networks

    • Interdisciplinary collaborations linking plant and medical research

When utilizing these resources, researchers should consider that different population types offer distinct advantages for specific research questions. For example, MAGIC populations provide the highest recombination frequency and shortest recombinant chromosomal segments (20.4 Mb), making them ideal for fine mapping, while DH populations offer simpler genetic structures but with longer recombinant segments (84.8 Mb) .

What are the most significant unresolved questions about Zea mays ND5 that warrant further investigation?

Several significant unresolved questions about Zea mays ND5 represent critical areas for future research:

  • Structure-function relationships:

    • How do plant-specific subunits interact with ND5 to modify Complex I function?

    • What is the precise mechanism coupling electron transfer to proton pumping in the plant system?

    • How do post-translational modifications regulate ND5 function under different conditions?

  • Evolutionary adaptations:

    • How has ND5 evolved to support C4 photosynthesis in maize?

    • What selective pressures have shaped ND5 sequence variation across maize landraces?

    • How do nuclear-mitochondrial co-adaptations ensure optimal respiratory function?

  • Stress response mechanisms:

    • How does ND5 function change under drought, heat, and other stresses?

    • What signaling pathways link ND5 activity to nuclear gene expression during stress?

    • How do alternative respiratory pathways compensate for altered ND5 function?

  • Regulatory networks:

    • What factors control the assembly of ND5 into functional Complex I?

    • How is the balance between hydrophobic and hydrophilic site activities regulated?

    • What determines the formation and stability of respiratory supercomplexes containing ND5?

  • Applied research priorities:

    • Can ND5 variants contribute to improved nitrogen use efficiency?

    • How do ND5 variants affect yield stability under fluctuating environments?

    • Can crop improvement programs specifically target mitochondrial function?

  • Methodological challenges:

    • How can we develop more efficient expression systems for recombinant ND5?

    • What approaches can accurately measure proton pumping in recombinant systems?

    • How can we better distinguish between direct and indirect effects of ND5 modifications?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.