Recombinant Zea mays Oleosin Zm-II (OLE18)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
OLE18; OLE3; Oleosin Zm-II; Lipid body-associated protein L2; Oleosin 18 kDa
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-187
Protein Length
Full Length of Mature Protein
Species
Zea mays (Maize)
Target Names
OLE18
Target Protein Sequence
ADRDRSGIYGGAHATYGQQQQQGGGGRPMGEQVKKGMLHDKGPTASQALTVATLFPLGGL LLVLSGLALTASVVGLAVATPVFLIFSPVLVPAALLIGTAVMGFLTSGALGLGGLSSLTC LANTARQAFQRTPDYVEEARRRMAEAAAQAGHKTAQAGQAIQGRAQEAGTGGGAGAGAGG GGRASS
Uniprot No.

Target Background

Function

Oleosin Zm-II (OLE18) likely plays a structural role in stabilizing lipid bodies during seed desiccation, preventing oil coalescence. It likely interacts with both lipid and phospholipid components of lipid bodies. It may also serve as a recognition signal for specific lipases during lipolysis in seedling growth.

Database Links

STRING: 4577.AC206941.2_FGP002

UniGene: Zm.19667

Protein Families
Oleosin family
Subcellular Location
Lipid droplet. Membrane; Multi-pass membrane protein. Note=Surface of oil bodies. Oleosins exist at a monolayer lipid/water interface.
Tissue Specificity
Found in embryonic axis, scutellum, and aleurone layer.

Q&A

What is Oleosin Zm-II (OLE18) and what is its primary function in maize seeds?

Oleosin Zm-II (OLE18) is an abundant structural protein found on the surface of intracellular oil bodies in maize (Zea mays L.) seeds. It belongs to the high-molecular weight (H) oleosin isoform group with an apparent molecular weight of approximately 18 kDa . The primary function of OLE18 is to stabilize oil bodies by preventing their coalescence during seed desiccation and rehydration. This protein plays a critical role in maintaining the structural integrity of lipid storage organelles throughout seed development, dormancy, and germination .

OLE18 is one of three major oleosins found in maize seeds, alongside OLE17 (another H-isoform) and OLE16 (a low-molecular weight or L-isoform). In most maize inbreds, these oleosins are present in oil bodies in proportional amounts of approximately 1:1:2 (OLE18:OLE17:OLE16) . This consistent ratio suggests tightly regulated expression and important functional relationships between these isoforms.

How does genetic variation in ole18 affect expression across maize varieties?

Genetic variation in the ole18 gene has significant impacts on protein expression across different maize inbred lines. Research has identified that in some inbreds, such as CM555, OLE18 is completely absent despite the presence of the ole18 gene. This absence occurs because the gene is transcriptionally inactive in these varieties . Similarly, in the FR2 inbred line, OLE17 is absent due to transcriptional inactivity of its corresponding gene.

Interestingly, when crossing CM555 × FR2, the F1 hybrid possesses both OLE18 and OLE17 proteins, demonstrating the inheritance and activation of both genes . This suggests that transcriptional regulation of oleosin genes varies across genotypes and can be complemented through hybridization.

In some maize inbreds, OLE18 and OLE17 occur as molecular weight variants with differences of 1000 Da or less, indicating allelic variation that affects protein size but potentially not function . These genetic variations provide valuable insights into the regulation of oleosin gene expression and can be exploited in breeding programs focused on altering oil body composition.

What expression systems are most effective for recombinant OLE18 production?

Escherichia coli represents the most widely used expression system for recombinant OLE18 production. Based on the available data, full-length OLE18 protein has been successfully expressed in E. coli with an N-terminal histidine tag (His-tag) . This approach offers several advantages:

  • High expression levels with relatively simple protocols

  • Well-established purification methods for His-tagged proteins

  • Cost-effectiveness for research-scale production

  • Ability to produce the full-length protein (amino acids 2-187)

The methodology typically involves:

  • Cloning the OLE18 coding sequence into an expression vector with an N-terminal His-tag

  • Transforming the construct into an appropriate E. coli strain

  • Inducing expression using IPTG or similar inducers

  • Cell lysis and protein extraction under conditions that maintain protein solubility

  • Purification via nickel affinity chromatography

While E. coli is effective, researchers should be aware that as a plant protein normally associated with lipid bodies, OLE18 has hydrophobic regions that may affect solubility. Expression conditions, including temperature, induction time, and buffer composition, often require optimization to maximize yield and quality .

What are the optimal storage and handling conditions for recombinant OLE18?

Recombinant OLE18 protein requires specific storage and handling conditions to maintain stability and functionality. Based on recommended protocols, the following guidelines should be observed:

  • Physical form: The protein is typically supplied as a lyophilized powder .

  • Reconstitution:

    • Centrifuge the vial briefly before opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol (final concentration) is recommended for long-term storage

  • Storage conditions:

    • Store reconstituted aliquots at -20°C/-80°C for long-term storage

    • For working solutions, store at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

  • Buffer conditions: The protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 or Tris-based buffer with 50% glycerol optimized for stability .

Researchers should note that proper aliquoting immediately after reconstitution is critical to prevent protein degradation from repeated freeze-thaw cycles. Additionally, when designing experiments, the presence of the His-tag should be considered as it may affect certain protein-protein or protein-lipid interactions.

What analytical methods are recommended for characterizing recombinant OLE18?

Several analytical methods are appropriate for characterizing recombinant OLE18 protein, each providing different information about protein quality, purity, and functionality:

  • SDS-PAGE: The primary method for assessing protein purity and approximate molecular weight. Recombinant OLE18 typically shows >90% purity by SDS-PAGE analysis . This technique can also verify the presence of the His-tag through Western blotting using anti-His antibodies.

  • Mass Spectrometry (MS):

    • MALDI-TOF MS for accurate molecular weight determination

    • LC-MS/MS for peptide mapping and identification of potential post-translational modifications

    • This is particularly important for verifying the presence of molecular weight variants that may differ by 1000 Da or less, as observed in some maize varieties

  • Circular Dichroism (CD): To analyze secondary structure content, especially important for confirming proper folding of the central hydrophobic domain.

  • Oil Body Association Assays: Functional characterization can include in vitro oil body formation assays to verify the protein's ability to associate with lipid droplets.

  • Dynamic Light Scattering (DLS): For analyzing the hydrodynamic properties of OLE18-stabilized oil bodies.

  • Differential Scanning Calorimetry (DSC): To assess thermal stability and folding properties of the recombinant protein.

When characterizing recombinant OLE18, researchers should compare their results with the expected features of the native protein, including molecular weight (approximately 18 kDa) and amino acid composition .

How can recombinant OLE18 be utilized in artificial oil body (AOB) systems?

Recombinant OLE18 offers significant advantages in the development and study of artificial oil body (AOB) systems, which are engineered lipid droplets that mimic natural oil bodies. Methodological approaches include:

  • AOB assembly protocol:

    • Preparation of an oil phase (typically triacylglycerols)

    • Emulsification with an aqueous phase containing phospholipids

    • Addition of purified recombinant OLE18 at concentrations between 0.1-1.0 mg/mL

    • Homogenization through sonication or high-pressure homogenization

    • Fractionation by centrifugation to isolate stable AOBs

  • Stability analysis:

    • Comparing AOBs formed with recombinant OLE18 versus those without oleosins

    • Measuring particle size distribution over time using dynamic light scattering

    • Assessing resistance to coalescence under various pH, temperature, and ionic strength conditions

  • Functional modifications:

    • Engineered OLE18 variants with modified hydrophobic domains to alter oil body size

    • Fusion of additional functional domains to create multifunctional AOBs

    • Site-directed mutagenesis to investigate structure-function relationships

These approaches allow researchers to understand the fundamental role of OLE18 in stabilizing oil bodies and explore biotechnological applications in areas such as drug delivery, enzyme immobilization, and functional food development.

What methods are effective for studying interactions between OLE18 and other oil body proteins?

Investigating interactions between OLE18 and other oil body proteins requires specialized techniques that can detect and quantify protein-protein interactions while accommodating the hydrophobic nature of these proteins:

  • Co-immunoprecipitation (Co-IP):

    • Using anti-OLE18 antibodies to pull down protein complexes

    • Identification of interacting partners through mass spectrometry

    • Western blot validation with antibodies against suspected interaction partners

  • Yeast two-hybrid (Y2H) system with membrane adaptations:

    • Modified Y2H systems designed for membrane and lipid-associated proteins

    • Split-ubiquitin Y2H particularly suitable for oleosins

  • Bimolecular Fluorescence Complementation (BiFC):

    • Expression of OLE18 and potential partners fused to complementary fragments of a fluorescent protein

    • Visualization of interactions in vivo within plant cells or heterologous systems

  • Förster Resonance Energy Transfer (FRET):

    • Labeling OLE18 and potential interacting proteins with appropriate fluorophore pairs

    • Measuring energy transfer as evidence of close proximity and interaction

  • Surface Plasmon Resonance (SPR):

    • Immobilization of OLE18 on sensor chips

    • Measuring binding kinetics with other purified oil body proteins

These methods can help elucidate the interactions between OLE18 and the other major oleosins (OLE17 and OLE16) as well as with additional oil body-associated proteins, providing insights into the molecular organization of oil bodies in maize seeds .

What is known about the transcriptional regulation of ole18 gene expression?

The transcriptional regulation of the ole18 gene involves complex mechanisms that determine its expression patterns during seed development. Based on available research, several key aspects of ole18 regulation have been identified:

  • Developmental regulation:

    • Expression is tightly controlled during seed development, with peak expression during oil accumulation phases

    • The ratio of oleosin isoforms (OLE18:OLE17:OLE16 = 1:1:2) is maintained in most maize inbreds, suggesting coordinated regulation of these genes

  • Tissue-specific expression:

    • ole18 is primarily expressed in the embryo tissues where oil bodies form

    • Expression levels appear similar in both diploidic embryos and triploidic aleurone layers

  • Transcriptional silencing:

    • In certain maize inbreds (e.g., CM555), the ole18 gene is present but transcriptionally inactive

    • This silencing may involve epigenetic mechanisms such as DNA methylation or histone modifications

    • The ability of hybrid crosses to restore expression (as in CM555 × FR2 F1 hybrids) suggests the involvement of trans-acting factors

  • Quantitative balance:

    • The observation that the total amount of high-molecular-weight oleosins (OLE18+OLE17) equals that of the low-molecular-weight oleosin (OLE16) suggests coordinated regulation of these gene families

Research methodologies to study ole18 transcriptional regulation typically include:

  • Promoter analysis using reporter gene constructs

  • Chromatin immunoprecipitation (ChIP) to identify transcription factor binding

  • DNA methylation analysis using bisulfite sequencing

  • Expression profiling across developmental stages and in response to environmental factors

What biotechnological applications have been developed using recombinant OLE18?

Recombinant OLE18 has been utilized in various biotechnological applications, leveraging its unique structural properties and ability to stabilize oil-water interfaces:

  • Recombinant protein production platforms:

    • OLE18 fusion proteins can be used to express and purify difficult recombinant proteins

    • The oleosin fusion system allows for simple purification through flotation centrifugation of oil bodies

    • Methodologically, this involves:

      • Creating gene fusions between OLE18 and target proteins

      • Expression in appropriate hosts (plants, yeast, or bacteria)

      • Recovery of fusion proteins via oil body isolation

      • Target protein release through protease cleavage at engineered sites

  • Crop improvement through genetic engineering:

    • Modulation of ole18 expression can alter oil body size and stability

    • In transgenic plants, manipulating the ratio between OLE18 and other oleosins can change oil content and composition

    • Biotechnologically engineered plants with modified ole18 expression may show improved yield traits related to oil storage

  • Bioactive compound delivery systems:

    • Artificial oil bodies stabilized by recombinant OLE18 can encapsulate hydrophobic compounds

    • These systems offer biocompatible alternatives to synthetic nanoparticles for drug delivery

  • Enzyme immobilization technology:

    • OLE18 can be fused with enzymes to create biocatalysts immobilized on oil bodies

    • This enables easy separation and reuse of enzymes in biotransformation processes

Each of these applications builds upon the fundamental understanding of OLE18 structure and function, particularly its ability to anchor firmly at the oil-water interface via its distinctive tripartite structure.

What are the key challenges in expressing functional recombinant OLE18?

Expressing fully functional recombinant OLE18 presents several technical challenges that researchers must address:

  • Protein solubility issues:

    • The central hydrophobic domain of OLE18 can cause aggregation during expression

    • Methodology to overcome this challenge includes:

      • Expression at reduced temperatures (16-20°C)

      • Use of specific E. coli strains designed for membrane proteins

      • Addition of mild detergents or amphipathic compounds to expression and purification buffers

  • Proper folding of the hydrophobic domain:

    • The hairpin structure of the central domain is critical for function but difficult to achieve in prokaryotic systems

    • Approaches to address this include:

      • Co-expression with molecular chaperones

      • Use of fusion partners that enhance solubility

      • Refolding protocols optimized for hydrophobic proteins

  • Post-translational modifications:

    • Plant-specific modifications may be absent in bacterial expression systems

    • Alternative expression platforms such as yeast or plant-based systems may be required for fully functional protein

  • Functional verification:

    • Demonstrating that recombinant OLE18 retains native oil body association capabilities

    • Development of appropriate assays to verify structural integrity and function

How can gene editing technologies be applied to study ole18 function in vivo?

Advanced gene editing technologies offer powerful approaches to investigate ole18 function directly in maize and other plants:

  • CRISPR/Cas9-based methodologies:

    • Precise knockout of ole18 to create null mutants

    • Introduction of specific mutations to investigate structure-function relationships

    • Promoter editing to alter expression patterns

    • Implementation protocol typically involves:

      • Design of guide RNAs targeting specific regions of ole18

      • Delivery via Agrobacterium-mediated transformation or biolistic methods

      • Regeneration and screening of edited plants

      • Phenotypic and molecular characterization

  • Base editing approaches:

    • Introduction of specific amino acid changes without double-strand breaks

    • Particularly useful for studying the functional importance of specific residues in the hydrophobic domain

  • Prime editing:

    • Enables precise edits including insertions, deletions, and all possible base-to-base conversions

    • Allows for more sophisticated genetic modifications to study regulatory elements

  • Promoter swap experiments:

    • Replacing the native ole18 promoter with constitutive or inducible promoters

    • Investigating the effects of altered expression patterns on oil body formation

These technologies can help answer fundamental questions about ole18 function, such as:

  • The role of specific domains in oil body targeting and stabilization

  • The phenotypic consequences of altering the ratio between different oleosin isoforms

  • The relationship between ole18 expression and oil accumulation during seed development

Research has shown that in certain maize inbreds, ole18 is transcriptionally inactive despite being present, suggesting complex regulatory mechanisms that could be further explored using these gene editing approaches .

What are the emerging research directions in oleosin biotechnology?

Emerging research in oleosin biotechnology, including work with OLE18, encompasses several promising directions:

  • Structural biology of oleosins:

    • Advanced techniques such as cryo-electron microscopy to resolve the three-dimensional structure of oleosins within oil bodies

    • Computational modeling of oleosin-lipid interactions

    • Understanding the molecular mechanisms of oil body stability at the atomic level

  • Designer oil bodies with customized properties:

    • Engineering OLE18 variants with altered hydrophobic domains to modify oil body size and stability

    • Creating chimeric oleosins combining features of different isoforms

    • Methodological approaches include:

      • Directed evolution to select for desired properties

      • Rational design based on structural insights

      • High-throughput screening of variant libraries

  • Metabolic engineering for bioactive compound production:

    • Using oil bodies as specialized compartments for synthesizing and storing high-value compounds

    • Engineering OLE18 fusion proteins that incorporate biosynthetic enzymes

    • Creation of artificial metabolons anchored to oil bodies via OLE18

  • Crop improvement through oleosin manipulation:

    • Altering oleosin expression patterns to increase oil content or modify oil composition

    • CRISPR-based approaches to modify regulatory elements controlling ole18 expression

    • These approaches could contribute to developing crops with improved yield characteristics, as suggested by research on other plant biotechnology applications

  • Biomedical applications:

    • Development of oleosin-stabilized artificial oil bodies for drug delivery

    • Recombinant OLE18 as a component in biocompatible emulsifiers

    • Oleosin-based adjuvants for vaccine development

These emerging directions build upon the fundamental understanding of oleosin structure and function while exploring novel applications that extend beyond traditional agricultural contexts.

What are the physicochemical properties of recombinant OLE18 protein?

The key physicochemical properties of recombinant Zea mays Oleosin Zm-II (OLE18) protein are summarized in the following table:

PropertySpecificationNotes
Amino acid length186 amino acids (positions 2-187)Full-length mature protein
Molecular weight~18 kDaBased on apparent molecular weight on SDS-PAGE
Isoelectric point (pI)8.5-9.0Estimated based on amino acid composition
HydrophobicityContains a central hydrophobic domainForms a hairpin structure that penetrates oil bodies
SolubilityLimited in aqueous solutionsRequires detergents or lipid environments for stability
Typical purity>90%As determined by SDS-PAGE analysis
Storage bufferTris/PBS-based with 6% trehalose, pH 8.0Recommended for lyophilized preparation
Alternative bufferTris-based with 50% glycerolOptimized for long-term stability
StabilityStable at -20°C/-80°C for extended periodsAvoid repeated freeze-thaw cycles

The protein's distinctive tripartite structure—consisting of a hydrophilic N-terminal domain, a highly conserved hydrophobic central domain, and a hydrophilic C-terminal domain—gives it unique properties that enable its function in stabilizing oil bodies.

What experimental systems have been used to study OLE18 interactions with lipids?

Several experimental systems and methodologies have been developed to study the interactions between OLE18 and lipids:

  • Artificial oil body (AOB) reconstitution:

    • Methodological approach:

      • Mixing purified recombinant OLE18 with phospholipids and triacylglycerols

      • Homogenization through sonication or microfluidization

      • Characterization by dynamic light scattering and microscopy

    • This system allows for controlled investigation of factors affecting oil body stability

  • Lipid monolayer insertion assays:

    • Using Langmuir troughs to create phospholipid monolayers

    • Measuring surface pressure changes upon addition of purified OLE18

    • Determining insertion kinetics and binding parameters

  • Liposome association studies:

    • Preparation of liposomes with varying lipid compositions

    • Incubation with recombinant OLE18

    • Analysis of protein-liposome complexes by density gradient centrifugation

    • Fluorescence-based assays to quantify binding

  • Native oil body isolation and reconstitution:

    • Extraction of oil bodies from maize seeds

    • Stripping of native proteins using chaotropic agents

    • Reconstitution with recombinant OLE18

    • Comparative analysis of stability and properties

  • Molecular dynamics simulations:

    • Computational modeling of OLE18 insertion into lipid bilayers

    • Prediction of protein-lipid interactions at the molecular level

    • Simulation of conformational changes during membrane association

These experimental systems provide complementary approaches to understand the molecular mechanisms by which OLE18 interacts with lipids to stabilize oil bodies, offering insights that can inform biotechnological applications of this protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.