Recombinant Zea mays Oleosin Zm-I (OLE16)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
OLE16; OLE1; Oleosin Zm-I; Lipid body-associated major protein; Lipid body-associated protein L3; Oleosin 16 kDa
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-156
Protein Length
Full Length of Mature Protein
Species
Zea mays (Maize)
Target Names
OLE16
Target Protein Sequence
ADHHRGATGGGGGYGDLQRGGGMHGEAQQQQKQGAMMTALKAATAATFGGSMLVLSGLIL AGTVIALTVATPVLVIFSPVLVPAAIALALMAAGFVTSGGLGVAALSVFSWMYKYLTGKH PPAADQLDHAKARLASKARDVKDAAQHRIDQAQGS
Uniprot No.

Target Background

Function
This protein may play a structural role in stabilizing lipid bodies during seed desiccation, preventing oil coalescence. It likely interacts with both lipid and phospholipid components of lipid bodies. It may also provide recognition signals for specific lipase anchoring during lipolysis in seedling growth.
Database Links
Protein Families
Oleosin family
Subcellular Location
Lipid droplet. Membrane; Multi-pass membrane protein. Note=Surface of oil bodies. Oleosins exist at a monolayer lipid/water interface.

Q&A

What is Oleosin Zm-I (OLE16) and what is its function in plant seeds?

Oleosin Zm-I (OLE16) is a 15.8 kDa protein belonging to the oleosin family found in maize (Zea mays). It plays a crucial structural role in stabilizing lipid bodies (oil bodies) during seed desiccation by preventing coalescence of stored oil . OLE16 interacts with both lipid and phospholipid moieties of lipid bodies and may provide recognition signals for specific lipase anchorage during lipolysis in seedling growth stages .

The significance of oleosins in seed development has been demonstrated through RNA interference (RNAi) studies in Arabidopsis, where suppression of the major oleosin (OLEO1) resulted in unusually large and irregular oil bodies . This phenotype disrupted storage organelles, altered lipid and protein accumulation, and delayed germination - highlighting the critical role of these proteins in seed physiology .

How does OLE16 compare to oleosins from other plant species?

BLAST analysis reveals significant sequence similarity between OLE16 and low molecular weight oleosins from other cereal species:

SpeciesOleosinSequence IdentityReference
Oryza sativa (rice)16 kDa oleosin (ole16)78%X82678.1
Hordeum vulgare (barley)Ole-2 (low molecular weight)78%U13701.1
Bromus secalinus (cheatgrass)16 kDa oleosin (ole16)74%U72411.1
Oryza sativa subsp. japonicaOleosin 16 kDaSimilar structure with 148 aa-

This high sequence conservation among monocot species indicates the functional importance of these proteins across different plant lineages . Oleosins from various species maintain similar functional domains despite some variations in sequence, allowing them to perform conserved roles in oil body stabilization.

What methodologies are used to isolate and characterize OLE16?

The full-length cDNA of OLE16 can be isolated through the following methods:

  • Construction of cDNA library from developing maize seeds

  • PCR amplification using gene-specific primers designed from known oleosin sequences

  • 5' RACE-PCR to obtain the 5'-end of the oleosin cDNA

  • End-to-end PCR to amplify the complete cDNA sequence

For protein analysis, researchers typically employ:

  • SDS-PAGE for molecular weight determination

  • Western blotting with specific antibodies

  • Mass spectrometry for protein identification and post-translational modification analysis

  • Confocal microscopy to visualize oil body morphology and distribution

What expression systems are optimal for producing recombinant OLE16?

While various expression systems can be used for recombinant OLE16 production, several factors affect the choice of system:

  • Plant-based expression: The linin seed-specific promoter from Linum usitatissimum has been successfully used to express OLE16 in Arabidopsis seeds . This promoter is a strong, seed-specific promoter with maximal transcription during the cotyledonary stage of seed development. Plant expression systems are advantageous when proper post-translational modifications are required.

  • Yeast expression: Yarrowia lipolytica might be suitable for OLE16 expression as it is an oleaginous yeast with sophisticated lipid metabolism machinery. It has gained GRAS status and has been used for various biotechnological applications involving lipid-related proteins .

  • Bacterial expression: While not mentioned specifically for OLE16 in the search results, bacterial systems like E. coli might be used with appropriate modifications to accommodate the hydrophobic domains of oleosins.

Key considerations for choosing an expression system include:

  • Proper folding of the hydrophobic domains

  • Targeting to lipid droplets (if functional studies are needed)

  • Scale of production required

  • Post-translational modification requirements

How can recombinant OLE16 be used to study oil body formation?

Recombinant OLE16 provides a valuable tool for studying oil body biogenesis and structure through several approaches:

  • Complementation studies: OLE16 has been successfully used to restore normal oil body morphology in Arabidopsis plants with suppressed OLEO1 expression. This approach demonstrated that OLE16 from maize, despite being phylogenetically distant from Arabidopsis oleosins, could functionally complement the loss of native oleosins .

  • Oil body size regulation: Studies show that oleosins determine oil body size by preventing their coalescence. By expressing different levels of recombinant OLE16, researchers can investigate the relationship between oleosin concentration and oil body morphology .

  • Protein-lipid interaction studies: Recombinant OLE16 can be used in artificial lipid body systems to study the physical mechanisms of oil body stabilization and the specific interactions between oleosins and phospholipids.

  • Structure-function analysis: Through site-directed mutagenesis of recombinant OLE16, researchers can identify critical residues and domains required for oil body targeting and stabilization.

What is the experimental design for using OLE16 to rescue oleosin-deficient phenotypes?

Based on research with Arabidopsis, the following experimental approach can be used to rescue oleosin-deficient phenotypes using recombinant OLE16:

  • Creation of oleosin-suppressed line:

    • Develop constructs for RNA interference (RNAi) targeting endogenous oleosins

    • Generate stable transgenic lines with reduced oleosin expression

    • Confirm the phenotype (enlarged oil bodies) through microscopy

  • Development of OLE16 expression line:

    • Create a construct with OLE16 under control of a seed-specific promoter (e.g., linin promoter)

    • Transform plants to generate the OLE16 expression line

    • Confirm OLE16 protein expression through Western blotting

  • Cross the two lines:

    • Manually cross oleosin-suppressed plants with OLE16-expressing plants

    • Select progeny showing both OLE16 expression and suppression of endogenous oleosins

    • Propagate for multiple generations to obtain homozygous lines

  • Phenotype analysis:

    • Analyze oil body morphology using confocal microscopy

    • Assess seed germination rates and seedling establishment

    • Evaluate seed lipid content and composition

    • Measure mobilization of triacylglycerols during germination

This approach allowed researchers to demonstrate that OLE16 from maize could partially restore normal oil body morphology in Arabidopsis with suppressed OLEO1 expression, confirming functional conservation across species .

What are the molecular mechanisms of OLE16 targeting to oil bodies?

The precise mechanisms of OLE16 targeting to oil bodies involve multiple factors:

  • Hydrophobic domain insertion: The central hydrophobic domain of OLE16 likely inserts into the phospholipid monolayer surrounding the oil body. This domain typically contains a characteristic proline knot motif that facilitates proper insertion .

  • Co-translational targeting: Evidence from studies of other oleosins suggests that targeting to oil bodies may occur co-translationally, with ribosomes associating with the endoplasmic reticulum where oil bodies form.

  • Temporal coordination: In native systems, oleosin expression is tightly coordinated with triacylglycerol synthesis and oil body formation during seed development. This temporal regulation ensures oleosins are available during oil body biogenesis .

To study these mechanisms experimentally, researchers could:

  • Create fluorescently tagged OLE16 constructs to track localization in vivo

  • Perform domain swapping experiments to identify regions critical for targeting

  • Use in vitro systems with artificial oil bodies to study binding properties

  • Analyze the timing of OLE16 expression relative to oil body formation during seed development

How does OLE16 interact with phospholipids and other oil body components?

OLE16 likely interacts with both lipid and phospholipid moieties of lipid bodies through its distinctive tripartite structure :

  • Hydrophobic domain interactions: The central hydrophobic domain penetrates the phospholipid monolayer, potentially reaching the triacylglycerol core. These interactions anchor the protein firmly within the oil body.

  • Amphipathic domain interactions: The N-terminal and C-terminal hydrophilic domains interact with the phospholipid headgroups and the aqueous cytosol, providing additional stability to the oil body interface.

  • Protein-protein interactions: OLE16 may form homo-oligomers or interact with other oil body proteins such as caleosins or steroleosins to create a comprehensive protein coat around oil bodies.

Experimental approaches to study these interactions include:

  • Biophysical methods (isothermal titration calorimetry, surface plasmon resonance)

  • Reconstitution experiments with purified components

  • Crosslinking studies to identify protein-protein interactions

  • Molecular dynamics simulations to model interactions at the atomic level

What factors affect the expression efficiency of recombinant OLE16?

Several factors can influence the expression efficiency of recombinant OLE16:

  • Promoter selection: The linin promoter has been successfully used for seed-specific expression of OLE16 in Arabidopsis . This promoter is particularly effective during the cotyledonary stage of seed development when oil bodies are forming.

  • Codon optimization: Adjusting the codon usage of the OLE16 sequence to match the preference of the expression host can significantly improve translation efficiency.

  • Hydrophobicity challenges: The hydrophobic nature of the central domain can cause protein aggregation or misfolding in some expression systems, potentially requiring specialized approaches:

    • Addition of solubility tags

    • Co-expression with chaperones

    • Expression in systems with robust lipid metabolism (e.g., Y. lipolytica)

  • Post-translational modifications: If specific modifications are required for OLE16 function, the expression system must be capable of performing these modifications correctly.

  • Expression timing: Coordinating OLE16 expression with oil body formation may be critical for proper integration into oil bodies and function.

How can OLE16 be used in biotechnological applications beyond basic research?

Recombinant OLE16 has potential applications in various biotechnological fields:

  • Oil body engineering: OLE16 could be used to create artificial oil bodies with controlled size and stability for various applications:

    • Delivery vehicles for hydrophobic compounds

    • Stabilization of emulsions in food or cosmetic products

    • Platforms for protein display and enzyme immobilization

  • Seed oil content modification: Understanding how oleosins like OLE16 regulate oil body formation could lead to strategies for increasing seed oil content in crops . Research has shown that modifications in seed storage proteins can affect both oil and protein content in seeds like soybean.

  • Protein purification systems: OLE16 could be used as a fusion tag for recombinant protein production, allowing for simple purification through oil body isolation and subsequent cleavage.

  • Synthetic biology applications: Engineered oil bodies with modified OLE16 variants could serve as specialized compartments within cells for sequestering metabolic pathways or products.

  • Cross-species functionality: The demonstration that maize OLE16 can functionally complement Arabidopsis oleosins suggests potential for using oleosins across species to modify oil body characteristics .

What are the challenges in maintaining functional integrity of recombinant OLE16?

Several technical challenges exist in producing and maintaining functional recombinant OLE16:

  • Protein aggregation: The highly hydrophobic central domain can cause aggregation during expression and purification. Solutions include:

    • Using detergents or lipid environments during purification

    • Expressing as fusion proteins with solubility-enhancing tags

    • Employing lipid-rich expression systems like Y. lipolytica

  • Structural confirmation: Verifying the proper folding and structure of recombinant OLE16 can be challenging due to its hydrophobic nature. Methods like circular dichroism spectroscopy in the presence of lipids may be needed to confirm proper structure.

  • Storage stability: Maintaining the functional integrity during storage requires careful consideration:

    • Storage with 50% glycerol at -20°C or -80°C for extended storage

    • Avoiding repeated freeze-thaw cycles

    • Preparing working aliquots that can be stored at 4°C for up to one week

  • Activity assessment: Unlike enzymes, oleosins don't have a catalytic activity that can be easily measured. Functional assessment typically requires oil body binding assays or microscopy-based approaches to evaluate oil body stabilization.

How can the genetic background influence OLE16 function in transgenic systems?

The genetic background of the host organism can significantly impact the function of recombinant OLE16:

  • Endogenous oleosins: The presence and expression levels of native oleosins can influence the phenotypic effect of recombinant OLE16. In complementation studies, researchers selected lines with confirmed suppression of endogenous oleosins to clearly observe the effect of recombinant OLE16 .

  • Oil body formation machinery: The host must have the cellular machinery for oil body formation if functional studies of OLE16 are planned. This includes enzymes for triacylglycerol synthesis and pathways for phospholipid production.

  • Promoter compatibility: The effectiveness of seed-specific promoters like the linin promoter may vary between species. The linin promoter has been shown to function well in Arabidopsis despite being derived from flax (Linum usitatissimum) .

  • RNAi considerations: When using RNAi to suppress endogenous oleosins while expressing recombinant OLE16, researchers must select oleosins that are phylogenetically distant to avoid cross-suppression. This strategy was employed successfully when expressing maize OLE16 in Arabidopsis with suppressed OLEO1 .

The importance of these factors highlights the need for careful experimental design when studying recombinant oleosins in heterologous systems.

What emerging techniques could advance OLE16 research?

Several cutting-edge techniques offer promising avenues for advancing OLE16 research:

  • CRISPR/Cas9 genome editing: This approach could enable precise modification of OLE16 or related genes in native maize, avoiding the limitations of RNAi-based approaches. Recent work with other plant genes demonstrates the potential of this technique .

  • Cryo-electron microscopy: This could provide high-resolution structural information about OLE16 within the context of intact oil bodies, revealing organization and interactions that are difficult to study with other methods.

  • Single-molecule techniques: Methods like single-molecule FRET could provide insights into the dynamics of OLE16 interactions with lipids and other proteins in real-time.

  • Artificial oil body systems: Reconstituted oil bodies with defined components could serve as minimalist systems to study the specific contributions of OLE16 to oil body formation and stability.

  • Multi-omics approaches: Integrating transcriptomics, proteomics, and lipidomics data could provide a comprehensive view of how OLE16 expression affects cellular metabolism and oil body composition.

How might OLE16 research contribute to crop improvement strategies?

Understanding the role of OLE16 and related oleosins in oil body formation has significant implications for crop improvement:

  • Increased oil content: Manipulating oleosin expression could potentially increase seed oil content by optimizing oil body formation and stability. This could lead to improved oil yields in crops like maize .

  • Enhanced seed quality: Proper oil body structure, mediated by oleosins, affects seed germination and seedling establishment. Optimizing oleosin expression could improve seed quality and vigor .

  • Stress tolerance: Oil bodies serve as energy reserves during stress conditions. Understanding how oleosins regulate these structures could contribute to developing crops with improved stress tolerance.

  • Specialized oil production: Engineering oil bodies through modified oleosins could facilitate the production of specialty oils or lipophilic compounds in seeds.

  • Biofortification strategies: Research on seed storage proteins and their relationship with oil content, such as that described for the MOTHER-OF-FT-AND-TFL1 gene in soybean, could be combined with oleosin studies to develop comprehensive strategies for seed composition improvement .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.