Recombinant Zea mays Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Zea mays Photosystem II CP47 Chlorophyll Apoprotein (psbB)

Recombinant Zea mays Photosystem II CP47 chlorophyll apoprotein, encoded by the gene psbB, is a crucial component of the photosynthetic apparatus in plants. It serves as a core antenna protein in the photosystem II (PSII) complex, which is essential for light harvesting and energy transfer during photosynthesis. While specific information on the recombinant form of this protein from Zea mays (corn) is limited, understanding its structure and function can be inferred from studies on similar proteins in other organisms.

Structure and Function of CP47

CP47, also known as the PSII 47 kDa protein, is a chlorophyll-binding apoprotein that plays a vital role in the PSII complex. It is involved in the stabilization of the PSII core and facilitates the binding of other subunits, such as the oxygen-evolving complex (OEC) proteins . The protein contains multiple chlorophyll molecules, which are essential for absorbing light energy and transferring it to the reaction center of PSII .

Assembly and Stability Factors

The assembly of CP47 into the PSII complex involves several factors, including Pam68, which stabilizes membrane segments of CP47 during chlorophyll insertion . Other proteins like PsbN are crucial for the assembly of the PSII reaction center but are not part of the core complex . The stability of CP47 and other apoproteins is influenced by chlorophyll binding, which is essential for their accumulation in the thylakoid membranes .

Research Findings and Implications

Studies on CP47 have shown that it is a critical component for efficient energy transfer in PSII. The chlorophyll molecules bound to CP47 have distinct excitation energies, which are influenced by the protein environment . Understanding these properties is essential for elucidating the mechanisms of photosynthesis and improving crop yields through genetic engineering.

Data Tables

While specific data tables for recombinant Zea mays CP47 are not available, general information on CP47 from other sources can be summarized as follows:

PropertyDescription
GenepsbB
FunctionCore antenna protein in PSII
Chlorophyll BindingEssential for light harvesting and energy transfer
Assembly FactorsPam68, PsbN (indirectly)
StabilityInfluenced by chlorophyll binding

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference for your own protocols.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Zea mays (Maize)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSISGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQA VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSDGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRDKEGRELFVRRMP TFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGTFQKVGDPTTRRQAA
Uniprot No.

Target Background

Function
CP47, a component of the core complex of photosystem II (PSII), plays a critical role in photosynthesis. It binds chlorophyll and facilitates the primary light-induced photochemical reactions within PSII. PSII, acting as a light-driven water:plastoquinone oxidoreductase, utilizes light energy to extract electrons from water, generating oxygen (O2) and a proton gradient. This gradient is subsequently used for ATP formation, a vital energy source for cellular processes.
Database Links
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Zea mays Photosystem II CP47 chlorophyll apoprotein?

Zea mays Photosystem II CP47 chlorophyll apoprotein (psbB) is a 47 kDa integral membrane protein that functions as one of the primary antenna systems in Photosystem II. The protein consists of 508 amino acids and binds 16 chlorophyll molecules that are essential for light-harvesting and efficient excitation energy transfer to the PSII reaction center . The protein serves as a crucial link in the photosynthetic electron transport chain, where it participates in the initial steps of light energy capture and transfer. The CP47 protein contains multiple transmembrane helices that anchor it within the thylakoid membrane, positioning the chlorophyll molecules optimally for energy absorption and transfer . This structural arrangement facilitates the charge-transfer excitation among coupled reaction center chromophores, which ultimately resolves into charge separation that initiates the electron transfer cascade driving oxygenic photosynthesis .

How does recombinant psbB differ from native protein in structure and function?

Recombinant Zea mays psbB protein is produced in expression systems such as E. coli, which differs substantially from its native chloroplast environment. While the amino acid sequence remains identical to the native protein (as shown in the provided sequence data), several functional differences may arise. Recombinant psbB is typically produced without its natural chlorophyll cofactors, requiring reconstitution for functional studies . The protein may also feature additional elements such as affinity tags (His-tags are common) to facilitate purification, which can affect certain biophysical properties .

During expression in heterologous systems, proper folding represents a significant challenge since the natural folding environment and assembly factors present in chloroplasts are absent. This often results in differences in tertiary structure compared to the native protein. Additionally, post-translational modifications that may occur in plants are generally absent in bacterial expression systems, potentially affecting protein stability and function . When designing experiments with recombinant psbB, researchers must carefully consider these differences and potentially validate findings with native protein when possible.

How do site energies of chlorophylls in CP47 affect excitation energy transfer pathways?

The site energies of chlorophyll molecules within CP47 substantially determine the pathways and efficiency of excitation energy transfer through the Photosystem II antenna system. Recent quantum mechanics/molecular mechanics (QM/MM) approaches utilizing time-dependent density functional theory have provided unprecedented insights into the excitation energy landscape of CP47 . Research has revealed that the 16 chlorophyll molecules within CP47 possess distinct site energies creating an energy funnel that directs excitation energy toward the reaction center.

The most significant finding contradicts earlier hypotheses about which chlorophylls serve as the lowest energy sites. Computational studies have identified chlorophyll B3, followed by B1, as the most red-shifted chlorophylls in CP47 . This arrangement creates an energy gradient that influences the directionality of energy transfer, with excitation energy preferentially moving toward these low-energy chlorophylls before transfer to the reaction center.

The protein environment exerts significant electrostatic effects on chlorophyll site energies. Charged amino acids, hydrogen bonding networks, and the local dielectric environment around each chlorophyll molecule can shift its absorption maximum by up to several nanometers. These protein-induced shifts are critical for establishing the proper energy landscape for efficient light harvesting . Researchers investigating energy transfer in CP47 should consider both the intrinsic properties of the chlorophylls and the modulating effects of the surrounding protein matrix.

What are the challenges in expressing and purifying functional recombinant psbB protein?

Expressing and purifying functional recombinant Photosystem II CP47 chlorophyll apoprotein presents several significant challenges. As an integral membrane protein with multiple transmembrane domains, psbB is inherently difficult to express in soluble form. Standard expression systems often lead to inclusion body formation, requiring specialized solubilization and refolding protocols .

Researchers have addressed these challenges through several innovative approaches:

  • Expression system selection: While E. coli remains the most common host for recombinant psbB production , alternative systems such as cell-free expression platforms or specialized bacterial strains designed for membrane protein expression have shown improved results.

  • Fusion tag strategies: The incorporation of solubility-enhancing tags (such as SUMO, thioredoxin, or maltose-binding protein) in addition to affinity tags can significantly improve expression yield and solubility.

  • Membrane mimetics: For functional studies, the purified protein must be incorporated into suitable membrane mimetics such as detergent micelles, nanodiscs, or liposomes that recreate the native lipid environment.

  • Chlorophyll reconstitution: Since bacterial expression systems do not produce chlorophyll, protocols for reconstituting the purified apoprotein with chlorophyll molecules have been developed, though achieving the correct stoichiometry and orientation remains challenging.

  • Validation of protein folding: Circular dichroism spectroscopy, limited proteolysis, and thermal stability assays are essential for confirming that the recombinant protein adopts a native-like conformation.

Each of these challenges represents an active area of research, with methodological improvements continuing to enhance our ability to produce functional recombinant psbB protein for structural and functional studies.

How can recombinant psbB be used in artificial photosynthetic systems?

Recombinant Zea mays psbB protein has significant potential applications in the development of artificial photosynthetic systems and biohybrid devices for solar energy conversion. The protein's evolved efficiency in capturing and transferring light energy makes it an attractive component for biomimetic light-harvesting systems.

Several approaches have been explored for incorporating recombinant psbB into artificial systems:

  • Biohybrid electrodes: Recombinant psbB can be immobilized on electrode surfaces to create photoactive interfaces. This typically involves protein attachment via engineered cysteine residues or affinity tags, allowing for controlled orientation on the electrode surface.

  • Protein-nanoparticle conjugates: The protein can be conjugated to semiconductor nanoparticles (quantum dots) to create hybrid structures that combine biological light-harvesting with synthetic electron transport components.

  • Reconstituted proteoliposomes: By incorporating psbB alongside other photosynthetic proteins into synthetic lipid vesicles, researchers can create minimal functional units that reproduce aspects of natural photosynthetic membranes.

  • Protein scaffolding approaches: Recent work has explored the use of engineered protein assemblies as scaffolds to position psbB and other components at defined distances and orientations, optimizing energy transfer efficiency.

The research challenges in this area include maintaining protein stability outside its native environment, achieving directional electron transfer, and integrating the biological components with synthetic materials. Progress in these areas requires interdisciplinary approaches combining protein engineering, surface chemistry, and materials science.

What techniques are most effective for structural characterization of recombinant psbB?

Structural characterization of recombinant Zea mays psbB requires a combination of complementary techniques to address the challenges associated with membrane proteins. The following approaches have proven most effective:

What spectroscopic methods best characterize the functional properties of recombinant psbB?

The functional characterization of recombinant Zea mays psbB protein relies heavily on various spectroscopic techniques that probe different aspects of protein-pigment interactions and energy transfer processes:

A comprehensive functional characterization typically combines several of these techniques. For example, a recent study utilized a multiscale quantum mechanics/molecular mechanics approach with time-dependent density functional theory to compute and map the excitation energies of all 16 chlorophylls in CP47 . This computational approach, validated with spectroscopic measurements, provided unprecedented insights into the electronic properties that determine function.

How should researchers design experiments to compare native and recombinant psbB protein?

Designing robust experiments to compare native and recombinant Zea mays psbB requires careful consideration of multiple factors to ensure valid comparisons. The following experimental design considerations are critical:

  • Protein preparation standardization:

    • Native protein should be carefully isolated from Zea mays thylakoid membranes using detergent solubilization followed by chromatographic purification

    • Recombinant protein expression conditions should be optimized for proper folding rather than maximum yield

    • Both preparations should undergo identical final purification steps to eliminate preparation-specific artifacts

  • Structural comparison methodology:

    • Circular dichroism spectroscopy to compare secondary structure content

    • Limited proteolysis to assess tertiary structure similarities

    • Thermal stability assays to compare conformational stability

    • Size-exclusion chromatography to assess oligomeric state

  • Functional assessment:

    • Chlorophyll binding stoichiometry determination

    • Absorption and fluorescence spectroscopy under identical conditions

    • Energy transfer efficiency measurements

    • Reconstitution into liposomes for membrane-dependent functions

  • Control experiments:

    • Analysis of the effects of any affinity tags on the recombinant protein

    • Evaluation of the impact of different detergents or membrane mimetics

    • Assessment of protein stability under experimental conditions

The experimental design should include appropriate statistical analyses, with measurements performed in triplicate at minimum. When reporting results, researchers should clearly document all preparation methods, buffer compositions, and measurement conditions to ensure reproducibility .

ParameterNative psbBRecombinant psbBAnalytical Method
Molecular Weight47 kDa (without modifications)Variable (depends on tags)SDS-PAGE, Mass Spectrometry
Chlorophyll Content16 chlorophylls per proteinVariable (requires reconstitution)Absorption Spectroscopy
Secondary Structure~65% α-helicalShould match nativeCircular Dichroism
Thermal StabilityTm typically 55-60°COften lower than nativeDifferential Scanning Calorimetry
Energy Transfer EfficiencyReference standardTypically lower than nativeTime-resolved Fluorescence

What biosafety considerations apply to research with recombinant psbB protein?

Research involving recombinant Zea mays Photosystem II CP47 chlorophyll apoprotein (psbB) necessitates adherence to specific biosafety guidelines and regulatory frameworks. According to the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules, work with recombinant proteins like psbB falls under defined regulatory oversight .

Key considerations include:

  • Regulatory compliance: Research institutions must establish an IBC with appropriate expertise to review protocols involving recombinant nucleic acids. This committee must include biosafety experts and specialists in plant experimental systems when working with plant-derived proteins like psbB .

  • Laboratory practices: Standard microbiological practices apply, including appropriate waste disposal, limiting access to laboratories during experiments, and decontamination of work surfaces.

  • Documentation requirements: Detailed records of experimental protocols, risk assessments, and any adverse events must be maintained in accordance with institutional and regulatory requirements.

  • Personnel training: All researchers working with recombinant materials must receive appropriate biosafety training, including specific instruction on the handling of expression systems and protein purification equipment.

While psbB itself is non-pathogenic, researchers should remain aware that the recombinant DNA technology used in its production is subject to oversight. Compliance with institutional biosafety policies and national regulations ensures both safety and regulatory conformity .

How can researchers validate the identity and purity of recombinant psbB preparations?

  • Identity confirmation:

    • Mass spectrometry: Intact protein mass analysis should match the theoretical mass calculated from the amino acid sequence plus any modifications (e.g., affinity tags) .

    • Peptide mapping: Tryptic digest followed by liquid chromatography-mass spectrometry (LC-MS/MS) can confirm sequence coverage and identify post-translational modifications.

    • Western blotting: Antibody detection using anti-psbB antibodies or anti-tag antibodies for recombinant variants provides specific identification.

    • N-terminal sequencing: Edman degradation of the first 5-10 amino acids can confirm the correct start of the protein.

  • Purity assessment:

    • SDS-PAGE: Should show a single major band at the expected molecular weight (approximately 47 kDa for the untagged protein) .

    • Size-exclusion chromatography: Can detect aggregates, oligomers, and lower molecular weight contaminants.

    • Isoelectric focusing: Reveals charge variants that may indicate deamidation or other modifications.

    • Analytical ultracentrifugation: Provides high-resolution analysis of sample homogeneity.

For quantitative purity assessment, densitometric analysis of stained gels can provide numerical purity values:

MethodAcceptance CriteriaTypical Results for High-Quality Preparation
SDS-PAGE>90% single band>95% main band with minimal contaminants
SEC-HPLC>90% main peak>95% monodisperse peak
Mass SpecMass accuracy ±0.1%Within 50 Da of theoretical mass
Peptide Mapping>80% sequence coverage>90% coverage with identified modifications

Researchers should establish appropriate acceptance criteria based on the intended application, with more stringent requirements for structural studies compared to functional screening assays .

How can protein engineering modify psbB for enhanced photosynthetic efficiency?

Protein engineering of Zea mays psbB offers promising avenues for enhancing photosynthetic efficiency through targeted modifications of its structure and function. Several strategic approaches have demonstrated potential for improving light-harvesting capabilities and energy transfer efficiency:

Recent computational approaches combining quantum mechanics and molecular mechanics offer powerful tools for predicting the effects of specific mutations before experimental validation . This allows for more targeted engineering efforts with higher success rates than traditional random mutagenesis approaches.

What role does psbB play in developing drought-resistant crop varieties?

The Photosystem II CP47 chlorophyll apoprotein (psbB) plays a significant yet underexplored role in developing drought-resistant crop varieties. As water scarcity becomes an increasingly critical agricultural challenge, understanding how photosynthetic machinery responds to drought stress offers potential targets for crop improvement.

Several aspects of psbB function relate directly to drought resistance mechanisms:

  • Photosynthetic efficiency under water stress: During drought conditions, plants typically close stomata to conserve water, limiting CO2 availability and potentially leading to photodamage through excess excitation energy. The efficiency of energy transfer through psbB becomes particularly critical under these conditions .

  • Reactive oxygen species (ROS) management: Water-limited conditions increase ROS production in chloroplasts. The structural integrity of psbB and its correct interaction with other PSII components can influence how effectively the photosynthetic apparatus manages this oxidative stress.

  • Recovery mechanisms: The rate at which photosynthesis can recover following drought stress relates partly to how quickly damaged PSII components, including psbB, can be repaired or replaced.

Comparative studies of psbB sequences and structures from drought-tolerant and drought-sensitive maize varieties have identified several amino acid substitutions that correlate with enhanced performance under water-limited conditions. These natural variations provide valuable targets for both traditional breeding approaches and genetic engineering strategies.

For targeted improvement strategies, several approaches show promise:

  • Allele mining from drought-tolerant varieties or wild relatives of maize

  • Targeted mutagenesis of specific residues identified through structure-function studies

  • Expression level modifications to optimize the stoichiometry of photosystem components

As drought becomes more prevalent in many agricultural regions, optimizing psbB function represents an important complementary approach to other drought tolerance mechanisms in comprehensive crop improvement programs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.