Recombinant Zea mays Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Research Applications and Key Findings

This recombinant protein is utilized to study PSII dynamics, protein processing, and herbicide interactions. Notable research includes:

Role in Thylakoid Protein Processing

Studies in Arabidopsis mutants (var2 and abc1k1) revealed that active PSII is required for proper processing of thylakoid preproteins. Under red light (680 nm), these mutants accumulated unprocessed intermediates of PSII-associated proteins (e.g., PsbA, PsbO1, PsbQ) . For example:

StudyGenotypeConditionObservationSource
Photosynthesis mutantsvar2Red lightAccumulation of incompletely cleaved thylakoid proteins (e.g., PsbQ, PsbP)
abc1k1Red lightDefects in chlorophyll levels and PSII quantum yield (ΦPSII)
DCMU treatmentabc1k1Low-dose DCMUPartial reversal of preprotein processing defects

These findings highlight the interdependence of PSII activity and protein maturation during chloroplast biogenesis .

Conformational Dynamics and Herbicide Binding

The D1 protein undergoes conformational changes that regulate QB-site accessibility. Molecular studies indicate that His215 in D1 is critical for QB-site function, with mutations affecting herbicide binding (e.g., atrazine) . The QB site’s structural flexibility also influences electron transfer efficiency in PSII .

Evolutionary and Physiological Significance

The D1 protein is evolutionarily conserved in plants, with recombination hotspots in maize (Zea mays) influencing genetic diversity . Its role in PSII function underscores its importance in photosynthetic adaptation and energy production .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your preferred tag type for prioritized development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; 32 kDa thylakoid membrane protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Zea mays (Maize)
Target Names
psbA
Target Protein Sequence
TAILERRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient for subsequent ATP formation. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several downstream electron acceptors.
Gene References Into Functions
  1. Reduced Deg1 enzyme levels in mesophyll chloroplasts from moderately-lit maize may hinder D1 repair processes in these plastids. PMID: 19450540
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for Recombinant Zea mays Photosystem Q(B) protein?

For optimal preservation of activity, Recombinant Zea mays Photosystem Q(B) protein should be stored at -20°C for routine storage, while extended storage periods require conservation at -80°C . The shelf life in liquid form is typically 6 months at these temperatures, while the lyophilized form maintains stability for up to 12 months .

Methodology for proper storage:

  • Avoid repeated freezing and thawing cycles as they significantly compromise protein integrity

  • Store working aliquots at 4°C for no longer than one week

  • Add glycerol to a final concentration of 5-50% for long-term storage preparations (50% is the standard recommendation)

  • Maintain in appropriate buffer conditions (typically Tris-based buffer with 50% glycerol)

How should Recombinant Zea mays Photosystem Q(B) protein be reconstituted for experimental use?

Proper reconstitution methodology for Recombinant Zea mays Photosystem Q(B) protein:

  • Briefly centrifuge the vial before opening to ensure all content collects at the bottom

  • Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • For experiments requiring longer-term stability, add glycerol to a final concentration of 5-50%

  • Aliquot the reconstituted protein to minimize future freeze-thaw cycles

  • Verify protein activity post-reconstitution using appropriate assays relevant to your experimental design

What is the relationship between Photosystem Q(B) protein and chlorophyll content in maize?

Photosystem Q(B) protein plays an integral role in photosynthetic efficiency, which is directly related to chlorophyll content (CC) in maize. Research has identified genes contributing to chlorophyll biosynthesis, such as GRMZM2G110408 (ZmCCS3), which significantly impact photosynthetic capacity .

The relationship between Q(B) protein and chlorophyll content involves:

What are the challenges in detecting Photosystem II membrane proteins like Photosystem Q(B) using mass spectrometry?

Detection of Photosystem II membrane proteins, including Q(B) protein, using mass spectrometry (MS) presents several technical challenges:

  • Physicochemical properties: Membrane proteins like PsbI and PsbJ of Photosystem II (between 29-40 aa in length with gravy index between 0.68 and 1.46) lack favorable peptides for detection by MS

  • Transmembrane domains: The Q(B) protein contains multiple hydrophobic transmembrane regions that resist standard proteolytic digestion methods

  • Extraction difficulties: Specialized protocols are required to solubilize membrane proteins while maintaining their structural integrity

ProteinLength (aa)Gravy IndexDetection Challenge
PsbI29-400.68-1.46Lacks favorable peptides for MS
PsbJ29-400.68-1.46Lacks favorable peptides for MS
NdhG1761.04Five transmembrane domains
Q(B)/D1344VariableMultiple hydrophobic domains

Methodological approaches to overcome these challenges include:

  • Use of alternative proteases beyond trypsin

  • Specialized membrane protein extraction techniques

  • Enrichment strategies for low-abundance membrane proteins

  • Advanced MS/MS fragmentation methods optimized for hydrophobic peptides

How can researchers differentiate between native and recombinant Zea mays Photosystem Q(B) protein in functional studies?

Researchers can employ several methodological approaches to differentiate between native and recombinant forms:

  • Spectroscopic analysis: Compare absorption and fluorescence spectra to identify structural differences in protein-pigment interactions

  • Electron transfer kinetics:

    • Measure electron transfer rates using artificial electron donors/acceptors

    • Compare half-lives of electron transfer reactions

    • Assess inhibitor binding constants at the Q(B) site

  • Protein-protein interaction profiling:

    • Native Q(B) protein exists in complex with other PSII components

    • Recombinant protein typically lacks these interaction partners

    • Use pull-down assays to identify differential binding partners

  • Post-translational modification (PTM) mapping:

    • Native protein contains specific PTMs absent in recombinant versions

    • LC-MS/MS analysis can identify these differences

    • Western blot with modification-specific antibodies

  • Thermal stability assessment:

    • Differential scanning calorimetry to compare unfolding temperatures

    • Thermal shift assays to assess structural stability differences

These approaches allow researchers to account for functional differences when interpreting experimental results using recombinant proteins as substitutes for native components .

What methodological approaches are most effective for studying the interaction of Photosystem Q(B) protein with other components of the photosynthetic apparatus?

Several specialized methodological approaches are particularly effective:

  • Cross-linking mass spectrometry (XL-MS):

    • Captures transient protein-protein interactions

    • Identifies specific contact points between Q(B) protein and other components

    • Provides spatial constraints for structural modeling

  • Reconstitution systems:

    • Incorporation of recombinant Q(B) protein into proteoliposomes

    • Step-wise assembly with purified components

    • Functional validation through electron transfer measurements

  • Single-molecule techniques:

    • FRET (Förster Resonance Energy Transfer) to measure dynamic interactions

    • Single-particle tracking to follow protein movement within membranes

    • Force spectroscopy to assess binding strengths

  • Genetic approaches:

    • Site-directed mutagenesis of interaction interfaces

    • Complementation studies in psbA deletion mutants

    • Screening of natural variants with altered interaction properties

  • Computational methods:

    • Molecular dynamics simulations of Q(B) protein with interacting partners

    • Protein-protein docking to predict interaction interfaces

    • Integration of experimental constraints with structural models

These techniques, often used in combination, provide comprehensive insights into the complex interaction network of Photosystem Q(B) protein .

What are the implications of post-translational modifications on Recombinant Zea mays Photosystem Q(B) protein function?

Post-translational modifications (PTMs) significantly impact Q(B) protein function:

  • Phosphorylation:

    • Affects protein turnover rates during photodamage-repair cycle

    • Influences interaction with repair machinery proteins

    • May alter electron transfer kinetics

  • Oxidative modifications:

    • Damaged Q(B) protein shows altered electron transfer efficiency

    • Specific residues (particularly D1-D170) are susceptible to ROS damage

    • Methodological detection using redox proteomics approaches

  • Expression system considerations:

    • Mammalian cell-produced recombinant proteins (as in commercial sources) may lack plant-specific PTMs

    • E. coli expression systems typically lack PTM machinery entirely

    • Plant-based expression systems provide more authentic modification patterns

  • Functional consequences:

    • Modified Q(B) protein exhibits altered herbicide binding properties

    • PTMs affect protein half-life in experimental systems

    • Interaction with other photosystem components can be modulated by modification state

Methodological approaches to study PTM effects include site-directed mutagenesis to mimic or prevent modifications, comparative proteomics between native and recombinant proteins, and functional assays under varying light conditions that induce different modification states.

How do genetic variations in the psbA gene affect Photosystem Q(B) protein structure and function across maize varieties?

Genetic variations in the psbA gene contribute to functional diversity of Q(B) protein:

  • Natural variation patterns:

    • Single nucleotide polymorphisms (SNPs) in the psbA gene exist across maize varieties

    • Most conservation occurs in functional domains (QB binding pocket, transmembrane regions)

    • Higher variability in stromal-exposed loops

  • Functional consequences:

    • Variants may exhibit differential photosynthetic efficiency

    • Environmental stress tolerance varies among natural psbA alleles

    • Herbicide resistance has been associated with specific mutations

  • Structure-function relationships:

    • Amino acid substitutions in the QB binding pocket directly impact electron transfer rates

    • Alterations in transmembrane domains affect protein stability and turnover

    • Surface residue changes influence interactions with other photosystem components

  • Methodological approaches:

    • Comparative genomics across maize varieties

    • Expression of variant proteins in model systems

    • Functional characterization using electron transfer measurements

    • Protein stability assessments under varying light conditions

  • Breeding implications:

    • Selection for optimal psbA variants could contribute to improved photosynthetic efficiency

    • Integration with other photosynthetic trait markers may enhance breeding outcomes

What role does the Photosystem Q(B) protein play in non-photochemical quenching mechanisms in maize?

The Q(B) protein plays several critical roles in non-photochemical quenching (NPQ) mechanisms:

  • Structural contribution:

    • Conformational changes in Q(B) protein influence PSII arrangement

    • These changes affect energy transfer pathways during NPQ activation

    • Interaction with PsbS protein (a key NPQ regulator) occurs during quenching

  • Redox signaling:

    • Electron transport through Q(B) affects thylakoid lumen pH

    • Acidification of lumen triggers NPQ mechanisms

    • Q(B) occupancy state influences excitation energy distribution

  • Species-specific adaptations:

    • Maize (C4 plant) shows different NPQ dynamics compared to C3 plants

    • Q(B) protein variants may contribute to these differences

    • Higher light tolerance in maize relates to coordinated NPQ responses

  • Methodological investigation approaches:

    • Chlorophyll fluorescence quenching analysis with Q(B) site inhibitors

    • Genetic manipulation of psbA to create variants with altered NPQ responses

    • Time-resolved spectroscopy to track energy dissipation pathways

    • Comparative analysis between maize varieties with different NPQ capacities

Understanding these mechanisms has implications for improving crop photosynthetic efficiency under fluctuating light conditions .

What analytical techniques are most effective for assessing the purity and activity of Recombinant Zea mays Photosystem Q(B) protein preparations?

Multiple analytical techniques should be employed to comprehensively assess recombinant protein quality:

  • Purity assessment techniques:

    • SDS-PAGE with Coomassie or silver staining (standard purity >85%)

    • Size exclusion chromatography to detect aggregates and contaminants

    • Mass spectrometry for precise identification and contaminant detection

    • Western blotting with specific antibodies

  • Structural integrity analysis:

    • Circular dichroism spectroscopy to verify secondary structure

    • Fluorescence spectroscopy for tertiary structure assessment

    • Limited proteolysis to evaluate proper folding

    • Native PAGE to assess oligomerization state

  • Functional activity assays:

    • Electron transfer measurements using artificial electron acceptors

    • Binding assays with QB site-specific inhibitors (DCMU, atrazine)

    • Reconstitution into liposomes for function in membrane environment

    • Oxygen evolution measurements in reconstituted systems

TechniquePurposeAcceptance Criteria
SDS-PAGEPurity assessment>85% single band
SEC-HPLCAggregation analysis<10% aggregated material
Inhibitor bindingFunctional assessmentKD within 2-fold of native protein
CD spectroscopySecondary structureCharacteristic α-helical signature
Electron transferActivity verificationMeasurable electron transfer rate

These complementary approaches ensure that recombinant protein preparations meet quality standards required for reliable research applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.