Recombinant Zea mays Probable phytol kinase, chloroplastic

Shipped with Ice Packs
In Stock

Description

Molecular Characterization and Function

Recombinant Zea mays probable phytol kinase (hereafter ZmVTE5) is a chloroplast-targeted enzyme involved in the phosphorylation of phytol, a diterpene alcohol derived from chlorophyll degradation. This enzyme catalyzes the ATP-dependent conversion of phytol to phytyl monophosphate (PMP), a critical step in regenerating phytyl diphosphate (PDP) for tocopherol (vitamin E) biosynthesis . ZmVTE5 belongs to the isoprenoid kinase family and shares homology with Arabidopsis VTE5 (At5g04490) and cyanobacterial homologs (e.g., slr1652) .

Key features:

  • Gene locus: GRMZM2GXXXXX (exact identifier pending annotation updates).

  • Protein structure: Predicted N-terminal chloroplast transit peptide, conserved ATP-binding motifs, and transmembrane domains .

  • Enzymatic specificity: Exhibits activity toward phytol, geranylgeraniol, and farnesol, with highest affinity for phytol .

Chloroplast Localization and Targeting

ZmVT5's chloroplast localization was experimentally confirmed using YFP fusion constructs. When expressed in Arabidopsis, native ZmVTE7 (a homolog) localized to chloroplast envelopes, but inefficient targeting necessitated swapping its transit peptide with Arabidopsis RecA's chloroplast transit peptide (cTP) for robust localization . Transient expression in protoplasts revealed association with chloroplast envelopes rather than thylakoid membranes .

Role in Tocopherol and Phylloquinone Biosynthesis

ZmVTE5 is essential for recycling phytol from chlorophyll degradation into the tocopherol pathway:

Metabolic PathwaySubstrateProductFunction
Chlorophyll degradationPhytolFree phytolReleased during senescence
ZmVTE5-mediated phosphorylationPhytol + ATPPhytyl monophosphatePrecursor for PDP synthesis
Subsequent phosphorylationPMP + ATPPhytyl diphosphateSubstrate for tocopherol/phylloquinone

Key findings:

  • ZmVTE5 knockout mutants accumulate free phytol and exhibit 70–80% reduced tocopherol levels in seeds .

  • Functional overlap exists with farnesol kinase (FOLK), which partially compensates for ZmVTE5 loss in phylloquinone synthesis .

Enzymatic Activity and Kinetic Properties

Recombinant ZmVTE5 expressed in E. coli membranes demonstrated the following in vitro activities :

SubstrateActivity (nmol/min/mg protein)Preferred Cosubstrate
Phytol12.4 ± 1.2CTP > UTP
Geranylgeraniol8.1 ± 0.9CTP
Farnesol5.3 ± 0.7CTP

Key observations:

  • No activity detected with GTP or TTP .

  • Enzyme activity is membrane-associated, consistent with its role in chloroplast envelope lipid metabolism .

Genetic and Functional Insights from Mutant Studies

  • ZmVTE5 overexpression: Restores tocopherol levels in Arabidopsis vte5 mutants but not in vte6 (lacking phytyl-P kinase), confirming its position upstream in the pathway .

  • Double mutants (vte5 folk): Lack tocopherol entirely but retain 40% phylloquinone, indicating alternative phytyl-PP sources for phylloquinone synthesis .

Evolutionary Conservation and Homology

ZmVTE5 shares 63% amino acid identity with Arabidopsis VTE5 and 58% with Synechocystis slr1652. Critical residues for ATP binding (e.g., GXXGXG motif) are conserved across species .

Research Applications and Biotechnological Potential

  • Metabolic engineering: Overexpression of ZmVTE5 in crops could enhance vitamin E content, as demonstrated in Arabidopsis transgenics .

  • Stress tolerance: Tocopherols protect chloroplast membranes from oxidative damage, suggesting ZmVTE5 as a target for improving stress resilience .

Unresolved Questions and Future Directions

  • Regulatory mechanisms: How is ZmVTE5 expression coordinated with chlorophyll degradation during senescence?

  • Interactions: Does ZmVTE5 form complexes with VTE6 or other kinases in chloroplast membranes?

  • Alternative substrates: Physiological relevance of geranylgeraniol/farnesol phosphorylation remains unclear .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please specify it when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Probable phytol kinase, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
50-303
Protein Length
Full Length of Mature Protein
Species
Zea mays (Maize)
Target Protein Sequence
AALAAAAPPAVLQDGAVTVLITAGAYSLVRVFDELTERRLIEKSLSRKVVHVLSGVLFMS SWPLFSNSTEARYFAAVVPFLNSMRLLIYGLRLYTDEALVKSVTREGKPEELLRGPLYYV LVLLFSVLVFWRESPIGIVSLSMMSGGDGFADIVGRRYGSAKLPFNRKKSWAGSISMFIS GFLLSAMMMLYFSSLGYIDVIWEEALGKLALVALAATVVECVPVTEVVDDNISVPLATML VAFLLFSSNRTIVN
Uniprot No.

Target Background

Function
Involved in the activation and reutilization of phytol from chlorophyll degradation in plant metabolism, including tocopherol biosynthesis. Catalyzes the conversion of phytol to phytol monophosphate (PMP).
Database Links

KEGG: zma:732748

STRING: 4577.GRMZM2G104538_P01

UniGene: Zm.15306

Protein Families
Polyprenol kinase family
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What is the primary function of phytol kinase in Zea mays chloroplasts?

Zea mays probable phytol kinase, chloroplastic (similar to VITAMIN E PATHWAY GENE5 [VTE5] in other plant species) primarily functions to phosphorylate phytol derived from chlorophyll degradation, converting it into phytyl phosphate (phytyl-P). This represents a crucial step in the recycling pathway that channels phytol into the synthesis of tocopherols (vitamin E) and phylloquinone (vitamin K) . The enzyme catalyzes the first step in the two-step phosphorylation process, with phytyl-P being further phosphorylated to phytyl diphosphate (phytyl-PP) by phytyl phosphate kinase (VTE6). In maize, as in other plants, this pathway is essential for channeling the phytyl moiety from chlorophyll turnover into other isoprenoid lipids.

What is the relationship between phytol kinase and vitamin biosynthesis in maize?

Phytol kinase plays a critical role in the biosynthesis of two essential vitamins in maize chloroplasts:

VitaminRole of Phytol KinaseConsequences of Deficiency
Tocopherols (Vitamin E)Provides the phytyl side chain essential for tocopherol structureComplete absence of tocopherols when both VTE5 and FOLK are knocked out
Phylloquinone (Vitamin K)Contributes partially to phylloquinone synthesisApproximately 60% reduction in phylloquinone levels when both VTE5 and FOLK are absent

The differential impact on these two vitamins indicates that while tocopherol synthesis is completely dependent on the phytol phosphorylation pathway in which phytol kinase participates, phylloquinone synthesis can partially proceed through alternative routes for obtaining phytyl moieties .

What are the optimal conditions for expressing recombinant Zea mays phytol kinase in heterologous systems?

For successful heterologous expression of recombinant Zea mays phytol kinase, researchers should consider a methodological approach similar to those used for other plant chloroplastic proteins. Based on approaches used for similar enzymes:

  • Expression Vector Selection: Utilize pCUN-NHF expression vector with an N-terminal tag (such as 3× Flag) for easy detection and purification .

  • Promoter Optimization: Employ the ubiquitin promoter which provides strong, constitutive expression in plant systems .

  • Host System Selection: While E. coli is commonly used for initial expression studies, insect cell systems may provide better folding for chloroplastic proteins with complex structures.

  • Purification Strategy: Implement a two-step purification approach using affinity chromatography followed by size exclusion chromatography to obtain highly pure enzyme.

  • Activity Testing: Develop in vitro assays using radiolabeled or fluorescently-labeled phytol to measure enzyme kinetics.

The recombinant protein should be tested for activity against multiple substrates including phytol, geranylgeraniol, and farnesol to establish substrate specificity profiles specific to the maize enzyme.

How can researchers effectively validate the in vivo function of Zea mays phytol kinase?

Validating the in vivo function of Zea mays phytol kinase requires a multi-pronged approach:

  • Gene Knockout/Knockdown: Generate knockout or knockdown maize lines using CRISPR/Cas9 or RNAi approaches.

  • Complementation Studies: Perform complementation experiments in mutant lines by reintroducing wild-type or modified versions of the phytol kinase gene, following approaches similar to those used for ZmBSK1 .

  • Metabolite Profiling: Conduct comprehensive metabolite profiling focusing on:

    • Tocopherol and phylloquinone levels

    • Phytol and phytyl-phosphate intermediates

    • Related isoprenoid compounds

  • Field Validation: Implement single-plant-omics approaches to analyze enzyme function under actual field conditions, which can provide insights different from laboratory-based studies .

  • Stress Response Analysis: Evaluate how enzyme function changes under various stress conditions, particularly those affecting chlorophyll turnover.

This comprehensive validation approach allows researchers to establish causality between enzyme activity and downstream metabolic consequences in the living plant.

What are the main challenges in purifying active recombinant Zea mays phytol kinase?

Purifying active recombinant Zea mays phytol kinase presents several technical challenges:

  • Solubility Issues: As a chloroplastic enzyme that may interact with membrane components, the recombinant protein often exhibits poor solubility. This can be addressed by:

    • Using solubility-enhancing fusion tags (MBP, SUMO)

    • Optimizing buffer conditions with mild detergents

    • Exploring truncated constructs that maintain the catalytic domain

  • Maintaining Activity: Chloroplastic enzymes often require specific conditions to maintain their native folding and activity:

    • Include stabilizing cofactors during purification

    • Optimize pH and salt concentrations based on chloroplast conditions

    • Consider including physiological concentrations of substrate analogs

  • Substrate Availability: Obtaining pure phytol substrate for activity assays can be challenging. Researchers can:

    • Extract phytol from chlorophyll

    • Utilize commercial sources with validation of purity

    • Synthesize labeled versions for sensitive detection

  • Protein Yield: Expression levels are often low for plant chloroplastic proteins. Strategies include:

    • Codon optimization for the expression host

    • Targeting expression timing and temperature

    • Using specialized expression strains

Careful protocol optimization addressing these challenges is crucial for obtaining functional enzyme for biochemical characterization.

How can researchers distinguish between the activities of phytol kinase and other related kinases in maize extracts?

Distinguishing between phytol kinase and related kinases (such as FOLK homologs) in maize extracts requires a methodical approach:

  • Substrate Specificity Profiling: Conduct parallel assays with different substrates:

    • Phytol (preferred by phytol kinase)

    • Farnesol (preferred by farnesol kinase)

    • Geranylgeraniol (utilized by both with different efficiencies)

  • Specific Inhibitors: Develop and employ selective inhibitors that target unique structural features of each enzyme.

  • Immunological Separation: Utilize specific antibodies for:

    • Immunoprecipitation prior to activity assays

    • Western blot analysis to correlate activity with protein levels

    • Immunodepletion experiments

  • Recombinant Standards: Compare kinetic parameters of crude extracts with purified recombinant enzymes.

  • Genetic Approaches: Analyze extracts from mutant lines with specific kinases knocked out to establish baseline activities.

This multi-faceted approach enables researchers to attribute observed kinase activities to specific enzymes in complex biological extracts.

How does the function of Zea mays phytol kinase compare to its Arabidopsis homologs?

Comparing Zea mays phytol kinase with its well-studied Arabidopsis homologs reveals important functional and evolutionary insights:

FeatureArabidopsis (VTE5/FOLK)Predicted Zea mays Phytol Kinase
Substrate SpecificityVTE5 and FOLK exhibit differential specificities for phytol, geranylgeraniol, and farnesol Likely shows similar substrate range but may have adapted specificity reflecting maize metabolism
Functional RedundancyPartial redundancy - vte5 has reduced tocopherol while vte5 folk lacks tocopherol completely Probable similar redundancy system with maize FOLK homologs
Contribution to PhylloquinoneBoth contribute partially with ~60% reduction in vte5 folk double mutant Likely similar partial contribution with alternative pathways present
Cellular LocalizationChloroplasticPredicted chloroplastic based on targeting sequences
Expression PatternsTissue-specific expressionMay show unique expression patterns adapted to maize development

The evolutionary conservation of this enzyme family between monocots and dicots suggests core functionality has been maintained, while regulatory elements and fine-tuning of activity may have diverged to accommodate species-specific metabolic requirements.

How do environmental factors influence the expression and activity of phytol kinase in field-grown maize?

Environmental factors likely have significant effects on phytol kinase expression and activity in field-grown maize, based on insights from single-plant-omics approaches:

  • Transcriptional Variation: Studies have shown substantial variability in gene expression profiles among individual maize plants grown in the same field, with a coefficient of variation (CV) of approximately 0.28 for the average transcript . This variation is 2.49 times higher than observed in laboratory-grown Arabidopsis plants .

  • Environmental Correlations: Field-grown plants show significant correlations between:

    • Transcriptome and metabolome profiles

    • Phenotypic traits and molecular profiles

    • Spatial position in the field and phenotypic traits

  • Stress Responses: Similar to other maize genes like ZmBSK1 that respond to environmental stresses , phytol kinase expression likely changes during:

    • Drought stress, affecting chlorophyll turnover

    • Temperature fluctuations

    • Nutrient availability variations

  • Developmental Regulation: Expression patterns likely vary across tissues and developmental stages, similar to other maize genes .

Researchers should consider these environmental influences when designing experiments and interpreting results, as laboratory findings may not directly translate to field conditions.

How can genetic engineering of Zea mays phytol kinase improve vitamin E content in maize?

Strategic genetic engineering of Zea mays phytol kinase offers promising approaches to enhance vitamin E (tocopherol) content in maize:

  • Overexpression Strategies:

    • Constitutive overexpression using strong promoters like ubiquitin

    • Tissue-specific overexpression targeting embryo and endosperm

    • Stress-inducible expression to enhance tocopherol production under stress conditions

  • Protein Engineering Approaches:

    • Structure-guided mutations to enhance catalytic efficiency

    • Substrate preference modifications to favor phytol phosphorylation

    • Stability enhancements to maintain activity under varying conditions

  • Pathway Co-engineering:

    • Coordinated enhancement of both VTE5 and VTE6 to remove potential bottlenecks

    • Upregulation of homogentisate synthesis to ensure adequate precursor supply

    • Targeted modification of alternative pathways to redirect flux

  • Regulatory Optimizations:

    • Modification of transcriptional regulation to respond to phytol availability

    • Post-translational regulation adjustments to maintain optimal enzyme levels

    • Promoter selection based on field-validated expression patterns

This multi-level engineering approach has the potential to significantly increase tocopherol content, enhancing the nutritional value of maize as a dietary source of vitamin E.

What roles might Zea mays phytol kinase play in stress response mechanisms?

Zea mays phytol kinase likely plays significant roles in stress response mechanisms through multiple pathways:

  • Oxidative Stress Protection: By facilitating tocopherol synthesis, phytol kinase contributes to:

    • Membrane protection against lipid peroxidation

    • Scavenging of reactive oxygen species (ROS)

    • Preservation of photosynthetic apparatus integrity

  • Chlorophyll Turnover Regulation: During stress-induced chlorophyll degradation, phytol kinase:

    • Helps recycle phytol from degraded chlorophyll

    • Prevents accumulation of potentially phototoxic intermediates

    • Contributes to energetic efficiency through resource recycling

  • Signaling Integration: The enzyme may participate in stress signaling networks:

    • Potentially interacting with MAPK cascades known to be important in maize stress responses

    • Coordinating with hormonal signaling pathways

    • Responding to retrograde signaling from chloroplasts to nucleus

  • Developmental Adaptation: Expression patterns may adjust during developmental transitions under stress:

    • Supporting reproductive tissue development during adverse conditions

    • Contributing to seed maturation stress tolerance

    • Enabling recovery processes after stress episodes

Understanding these stress response functions could inform breeding strategies for developing more resilient maize varieties with enhanced stress tolerance.

What analytical methods are most effective for quantifying phytol kinase activity in maize tissues?

For accurate quantification of phytol kinase activity in maize tissues, researchers should employ a combination of analytical approaches:

  • Enzyme Activity Assays:

    • Radiometric assays using 14C-labeled phytol to track phosphorylation

    • HPLC-based methods to separate and quantify phytyl-phosphate products

    • Coupled enzymatic assays that link ATP consumption to detectable signals

  • Protein Quantification:

    • Western blotting with specific antibodies against maize phytol kinase

    • Mass spectrometry-based targeted proteomics (MRM/PRM) for absolute quantification

    • ELISA-based approaches for high-throughput screening

  • Gene Expression Analysis:

    • Quantitative RT-PCR using gene-specific primers (similar to methods used for ZmBSK1)

    • RNA-seq for genome-wide expression context

    • Single-plant transcriptomics for field-grown plants

  • Metabolite Profiling:

    • LC-MS/MS quantification of pathway intermediates and products

    • Isotope tracing to track flux through the pathway

    • Untargeted metabolomics to identify unexpected metabolic effects

  • Data Integration:

    • Correlation analysis between enzyme activity, protein levels, and metabolite concentrations

    • Multivariate statistical approaches to identify patterns across datasets

    • Machine learning models to predict phenotypic outcomes from molecular data

This comprehensive analytical toolkit enables researchers to develop a complete picture of phytol kinase function in diverse maize tissues and conditions.

How can researchers interpret contradictory results between laboratory and field studies on phytol kinase function?

Interpreting contradictory results between laboratory and field studies requires systematic consideration of multiple factors:

  • Environmental Complexity: Field environments introduce numerous variables absent in laboratory settings:

    • Diurnal temperature fluctuations affect enzyme kinetics

    • Solar radiation patterns influence chlorophyll turnover

    • Soil microbiome interactions affect plant metabolism

    • Combine these factors when designing validation experiments

  • Temporal Dynamics: Laboratory studies often examine single time points, while field studies capture seasonal variations:

    • Implement time-series sampling in both settings

    • Consider developmental stage-specific effects

    • Account for circadian rhythms in enzyme expression and activity

  • Genetic Background Effects: Laboratory studies often use model lines that may differ from field varieties:

    • Test findings across multiple genetic backgrounds

    • Consider epigenetic differences between lab and field plants

    • Evaluate interactions with other genetic factors

  • Analytical Approach Refinement:

    • Apply single-plant-omics approaches to capture individual plant variability

    • Utilize field transcriptomes to predict gene function

    • Develop statistical models that account for field variability

  • Bridging Strategies:

    • Design stepped experiments that gradually increase environmental complexity

    • Implement controlled field environments (e.g., rainout shelters, temperature gradient tunnels)

    • Develop mathematical models that predict field outcomes from laboratory parameters

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.