Recombinant Zea mays Protein brittle-1, chloroplastic/amyloplastic (BT1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them when placing your order. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
BT1; Adenine nucleotide transporter BT1, chloroplastic/amyloplastic/mitochondrial; Protein brittle-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
76-436
Protein Length
Full Length of Mature Protein
Species
Zea mays (Maize)
Target Names
BT1
Target Protein Sequence
ADNCDIAASLAPPFPGSRPPGRRGRGSEEEEAEGRRHEEAAAAGRSEPEEGQGQDRQPAP ARLVSGAIAGAVSRTFVAPLETIRTHLMVGSIGVDSMAGVFQWIMQNEGWTGLFRGNAVN VLRVAPSKAIEHFTYDTAKKFLTPKGDEPPKIPIPTPLVAGALAGFASTLCTYPMELIKT RVTIEKDVYDNVAHAFVKILRDEGPSELYRGLTPSLIGVVPYAACNFYAYETLKRLYRRA TGRRPGADVGPVATLLIGSAAGAIASSATFPLEVARKQMQVGAVGGRQVYQNVLHAIYCI LKKEGAGGLYRGLGPSCIKLMPAAGIAFMCYEACKKILVDKEDEEEEDEAGGGEDDKKKV E
Uniprot No.

Target Background

Function
This protein is likely an adenylate translocator responsible for mediating the transport of ADP-glucose into endosperm storage plastids during starch synthesis. It facilitates the movement of cytosolic ADP-glucose to amyloplast stroma via counter-exchange with ADP.
Database Links

UniGene: Zm.155

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein. Plastid, amyloplast inner membrane; Multi-pass membrane protein. Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in silks and endosperm of developing kernels. Expressed at intermediate levels in tassels and lower levels in stems and leaves.

Q&A

What is Zea mays Protein brittle-1 (BT1) and what is its functional significance?

Zea mays Brittle1-1 (ZmBT1-1) is an essential component of the starch biosynthetic machinery in maize endosperms. Its primary function involves facilitating the transport of ADPglucose from the cytosol to amyloplasts in exchange for AMP or ADP, thus playing a critical role in starch synthesis . Though initially characterized as an amyloplast-specific marker, recent research has revealed that ZmBT1-1 is dually localized to both plastids and mitochondria, suggesting additional functional roles beyond starch biosynthesis . ZmBT1-1 belongs to the Mitochondrial Carrier Family (MCF) of proteins that are unique to plants .

How many BT1 homologs exist in maize and what characterizes their expression patterns?

At the transcriptional level, maize plants express two BT1 homologs: ZmBT1-1 and ZmBT1-2 . These homologs exhibit distinct expression patterns that suggest specialized functions:

  • ZmBT1-1: Shows developmentally regulated expression, with high levels in maize endosperms 12-25 days after pollination (DAP) but undetectable expression in non-endosperm tissues and suspension cultures .

  • ZmBT1-2: Demonstrates a ubiquitous expression pattern across both heterotrophic and autotrophic tissues .

This differential expression suggests that while ZmBT1-2 may serve a general function across various tissue types, ZmBT1-1 has evolved specialized functions specific to endosperm development and starch accumulation.

What approaches can be used to investigate the subcellular localization of ZmBT1-1?

Investigating the subcellular localization of ZmBT1-1 requires complementary experimental approaches to confirm its presence in multiple compartments:

  • Confocal Fluorescence Microscopy: Generate stable transgenic plants expressing GFP fusions of ZmBT1-1 to visualize its subcellular distribution. This approach has successfully demonstrated the dual localization of ZmBT1-1 to both plastids and mitochondria .

  • Electron Microscopic Immunocytochemistry: Utilize gold-labeled antibodies specific to ZmBT1-1 for high-resolution localization studies in maize endosperm tissue sections. This technique provides definitive evidence of protein presence in specific organelles .

  • Subcellular Fractionation: Isolate purified organellar fractions (plastids, mitochondria) followed by Western blot analysis using ZmBT1-1-specific antibodies to quantify relative distribution between compartments.

  • Protease Protection Assays: Determine the topology of ZmBT1-1 within organellar membranes by treating isolated organelles with proteases in the presence or absence of membrane-disrupting detergents.

How can researchers effectively generate and validate transgenic Zmbt1-1 plants?

Generating transgenic Zmbt1-1 plants for functional studies requires careful experimental design and validation:

  • Mutant Selection: Obtain Zmbt1-1 mutant lines such as the bt1-m1::dSpm reference line (available from the Maize Genetics COOP Stock Center), which contains a ~3.3 kbp defective Suppressor-mutator (dSpm) insertion in the third exon of ZmBT1-1 .

  • Construct Design: Prepare expression constructs containing:

    • Full-length ZmBT1-1 (UBI-ZmBT1-1)

    • Truncated ZmBT1-1 lacking the plastidial transit peptide (UBI-ΔTP-ZmBT1-1)

    • Mitochondria-targeted truncated ZmBT1-1 (UBI-MitTPr-ΔTP-ZmBT1-1)

  • Transformation Protocol: Transform Zmbt1-1 plants using established Agrobacterium-mediated or biolistic transformation methods.

  • Validation Methods:

    • PCR confirmation using gene-specific primers (e.g., O1: 5′-CGAGACGCTGAAGCGGCTCTAC-3′ and O2: 5′-CACGATCCGGAAACACCACATC-3′) and insertion-specific primers (e.g., dSpm-specific O3: 5′-GGACTTGAACTTGTATGAATATTG-3′)

    • DNA sequencing of PCR amplicons

    • Western blot analysis to confirm protein expression

    • Phenotypic assessment of transgenic plants compared to wild-type and mutant controls

What proteomic approaches are most effective for studying ZmBT1-1 function?

High-throughput proteomic analyses provide crucial insights into ZmBT1-1 function and its impact on cellular metabolism:

  • Isobaric Labeling-Based Differential Proteomics: This approach effectively identifies differentially expressed proteins between wild-type and Zmbt1-1 endosperms. In previous studies, this technique revealed 414 differentially expressed proteins out of 2,183 identified proteins in Zmbt1-1 compared to wild-type endosperms .

  • Functional Classification: Organize differentially expressed proteins using ontology systems such as MapMan to identify affected metabolic pathways. Previous studies classified 379 differentially expressed proteins with known functions into 25 functional groups .

  • Targeted Protein Analysis: Focus on specific protein families affected by ZmBT1-1 mutation, such as:

    • Starch metabolism enzymes (e.g., soluble starch synthase isoforms)

    • Sucrose metabolism enzymes (e.g., sucrose synthase SH1, cell wall invertase CWI-2)

    • Glycolytic enzymes

    • TCA cycle components

    • Fermentation pathway enzymes

  • Comparative Proteomic Analysis: Compare proteomic profiles between multiple genotypes (e.g., wild-type, Zmbt1-1, and Zmbt1-1::MitTPr-ΔTP-ZmBT1-1) to differentiate functions of mitochondrial versus plastidic ZmBT1-1 .

What metabolic analyses complement proteomic studies of ZmBT1-1 function?

To comprehensively understand ZmBT1-1's role in endosperm metabolism, researchers should employ multiple metabolic analyses:

  • Starch Content and Composition Analysis: Quantify total starch, amylose/amylopectin ratio, and branching patterns to assess the impact of ZmBT1-1 mutation on starch biosynthesis.

  • Soluble Sugar Profiling: Measure glucose, fructose, sucrose, and other soluble carbohydrates to evaluate alterations in carbon partitioning.

  • Fermentation Metabolites: Analyze ethanol and alanine levels, which are elevated in Zmbt1-1 endosperms due to enhanced CWI-mediated channeling of sucrose into fermentation pathways .

  • Enzymatic Activity Assays: Measure activities of key enzymes in starch synthesis, sucrose metabolism, and glycolysis to correlate protein abundance with functional activity.

  • Isotope Labeling Studies: Utilize 13C-labeled substrates to trace carbon flux through different metabolic pathways in wild-type versus mutant endosperms.

How does mitochondrial ZmBT1-1 influence carbon metabolism in maize endosperm?

Mitochondrial ZmBT1-1 plays a crucial role in determining the metabolic fate of sucrose entering endosperm cells:

  • Regulation of Sucrose Utilization Pathways: In the absence of mitochondrial ZmBT1-1, there is:

    • Down-regulation of sucrose synthase (SuSy)-mediated channeling of sucrose into starch metabolism

    • Up-regulation of the conversion of sucrose breakdown products generated by cell wall invertase (CWI) into ethanol and alanine

  • Mitochondrial Function: Electron microscopic analyses of Zmbt1-1 endosperm cells revealed gross alterations in mitochondrial ultrastructure, suggesting that mitochondrial ZmBT1-1 is essential for normal mitochondrial function .

  • Metabolic Rescue: The aberrant protein expression pattern, metabolic profile, and mitochondrial ultrastructure of Zmbt1-1 endosperms can be rescued by delivering ZmBT1-1 specifically to mitochondria, confirming the importance of mitochondrial ZmBT1-1 in carbon metabolism .

  • Nucleotide Exchange: Mitochondrial ZmBT1-1 may be involved in the exchange between intramitochondrial AMP and cytosolic ADP, influencing cellular energy status and carbon flux .

What experimental design is most effective for distinguishing the functions of plastidic versus mitochondrial ZmBT1-1?

To differentiate between the functions of plastidic and mitochondrial ZmBT1-1, researchers should implement a comprehensive experimental design:

  • Organelle-Specific Complementation:

    • Generate transgenic Zmbt1-1 plants expressing ZmBT1-1 targeted exclusively to plastids

    • Generate transgenic Zmbt1-1 plants expressing ZmBT1-1 targeted exclusively to mitochondria (e.g., Zmbt1-1::MitTPr-ΔTP-ZmBT1-1)

    • Compare phenotypic, proteomic, and metabolic parameters between these lines and wild-type plants

  • Comparative Phenotypic Analysis:

    • Assess starch content and composition

    • Analyze endosperm development and kernel morphology

    • Measure plant growth parameters and yield components

    • Evaluate organellar ultrastructure using electron microscopy

  • Biochemical Analysis:

    • Measure ADPglucose transport in isolated plastids and mitochondria

    • Assess nucleotide exchange capacity in both organelles

    • Determine the impact on respiratory metabolism and ATP production

  • Statistical Validation: Apply rigorous statistical analysis (e.g., Student's t-test) to evaluate the significance of differences between wild-type, Zmbt1-1, and transgenic complementation lines .

How can knowledge about ZmBT1-1 function be applied to improve crop productivity?

Understanding ZmBT1-1 function has significant implications for crop improvement strategies:

What are the most promising directions for future research on ZmBT1-1?

Future research on ZmBT1-1 should focus on several key areas:

What are the critical controls required for transgenic ZmBT1-1 studies?

When designing experiments involving transgenic manipulation of ZmBT1-1, researchers should include these essential controls:

  • Genetic Background Controls:

    • Wild-type plants of the same genetic background (e.g., W23/M14/W64A hybrid background)

    • Original Zmbt1-1 mutant plants without transgenic modification

    • Plants expressing non-functional ZmBT1-1 variants to control for protein overexpression effects

  • Subcellular Targeting Controls:

    • Expression of fluorescent marker proteins with known plastidial or mitochondrial targeting

    • Western blot analysis of purified organellar fractions to confirm targeting specificity

    • Microscopic visualization of subcellular localization

  • Expression Level Controls:

    • Quantitative RT-PCR to measure transgene expression

    • Western blot analysis to compare protein levels between transgenic and wild-type plants

    • Multiple independent transgenic lines to account for position effects

  • Developmental Stage Controls:

    • Sample collection at multiple developmental stages (e.g., 12, 18, 24, and 30 DAP)

    • Comparison with wild-type development at equivalent stages

    • Assessment of phenotypes across multiple growing seasons

  • Environmental Controls:

    • Standardized growth conditions for all genotypes being compared

    • Field trials in multiple locations to assess environmental influences

    • Proper experimental design with replications and randomization

How should researchers address potential data inconsistencies in ZmBT1-1 studies?

When facing data inconsistencies or contradictions in ZmBT1-1 research, investigators should:

  • Validate Key Findings Through Multiple Approaches:

    • Combine molecular, biochemical, and genetic methods to verify results

    • Use both in vitro and in vivo experimental systems

    • Apply multiple analytical techniques to measure the same parameter

  • Address Technical Limitations:

    • Evaluate the specificity of antibodies used for immunodetection

    • Assess the purity of subcellular fractions in organelle isolation procedures

    • Consider the impact of extraction methods on protein activity and stability

  • Account for Genetic Background Effects:

    • Compare mutant phenotypes across different genetic backgrounds

    • Use nearisogenic lines to minimize background effects

    • Generate multiple independent transgenic lines

  • Statistical Rigor:

    • Apply appropriate statistical tests for experimental data analysis

    • Include sufficient biological and technical replicates

    • Report effect sizes and confidence intervals along with p-values

  • Transparent Reporting:

    • Clearly document all experimental conditions and procedures

    • Acknowledge limitations of experimental approaches

    • Present negative or conflicting results alongside positive findings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.