Recombinant Zelotomys hildegardeae Cytochrome c oxidase subunit 2 (MT-CO2)

What is Zelotomys hildegardeae Cytochrome c Oxidase Subunit 2 (MT-CO2)?

Zelotomys hildegardeae Cytochrome c Oxidase Subunit 2 (MT-CO2) is a mitochondrial protein encoded by the MT-CO2 gene in Hildegarde's broad-headed mouse (Zelotomys hildegardeae), a rodent species found in the Somali-Masai region of eastern Africa. This protein is a critical component of respiratory chain complex IV (cytochrome c oxidase), serving as one of the catalytic core subunits essential for the reduction of oxygen to water during cellular respiration. The MT-CO2 subunit specifically transfers electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1 . The protein consists of 227 amino acids and has a molecular weight of approximately 26 kDa .

How does Zelotomys hildegardeae MT-CO2 differ from other species' MT-CO2?

Comparing the amino acid sequences of MT-CO2 from different species reveals specific variations that may reflect evolutionary adaptations. For instance, the MT-CO2 sequence of Zelotomys hildegardeae (MAYPLQLGLQDATSPIMEELMNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAVILIMIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDSYMVPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKHFENWSASMI) shows distinct differences from that of Arvicanthis somalicus (Somali grass rat), which has the sequence: MAYPFQLGLQDATSPIMEELTNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAAILILIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWTVPSLGLKTDAIPGRLNQATLSSNRPGLYYGQCSEICGSNHSFMPIVLEMVPLKYFENWSTSMI . Key differences are highlighted in positions where amino acid substitutions occur, potentially affecting protein function and stability in different environmental conditions.

What are the specifications of commercially available recombinant Z. hildegardeae MT-CO2?

The recombinant full-length Zelotomys hildegardeae MT-CO2 protein is typically produced with an N-terminal His-tag, expressed in E. coli expression systems. The protein specifications include:

The recombinant protein maintains the complete amino acid sequence of the native protein, making it suitable for various research applications including functional studies, antibody production, and structural analyses .

How should recombinant Z. hildegardeae MT-CO2 be stored and reconstituted for optimal stability?

For optimal stability and functionality of recombinant Z. hildegardeae MT-CO2:

• Storage recommendations:

  • Store the lyophilized powder at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

• Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended default is 50%)

  • Aliquot for long-term storage at -20°C/-80°C

Repeated freezing and thawing significantly reduces protein stability and should be avoided. The storage buffer (Tris/PBS-based buffer with 6% Trehalose, pH 8.0) is optimized to maintain protein integrity during storage .

What are the primary research applications for recombinant Z. hildegardeae MT-CO2?

Recombinant Z. hildegardeae MT-CO2 can be utilized in multiple research contexts:

• Evolutionary biology studies:

  • Comparative analysis of MT-CO2 across rodent species to explore evolutionary relationships

  • Investigation of adaptive changes in mitochondrial proteins across ecological gradients in the Somali-Masai region

• Biochemical and functional characterization:

  • Protein-protein interaction studies with other components of the respiratory chain

  • Enzymatic activity assays measuring electron transfer capabilities

  • Structural studies through crystallography or cryo-electron microscopy

• Immunological applications:

  • Generation of specific antibodies against Z. hildegardeae MT-CO2

  • Immunoprecipitation experiments to identify binding partners

  • Immunohistochemistry and immunofluorescence studies in tissue samples

• Biomedical research:

  • Comparative studies with human MT-CO2 to understand functional conservation

  • Investigation of MT-CO2 mutations associated with mitochondrial disorders

  • Exploration of potential roles in metabolic adaptation under glucose deprivation conditions

How can researchers verify the identity and purity of recombinant Z. hildegardeae MT-CO2?

Comprehensive verification of recombinant Z. hildegardeae MT-CO2 identity and purity should involve multiple analytical techniques:

• SDS-PAGE analysis:

  • Expected band at 23-26 kDa

  • Purity assessment (should be >90%)

  • Comparison with positive control

• Western blot verification:

  • Using anti-His tag antibodies to detect the fusion protein

  • Using specific MT-CO2 antibodies (if available)

• Mass spectrometry:

  • Peptide mass fingerprinting

  • Sequence verification through MS/MS analysis

• Functional assays:

  • Copper binding capacity assessment through ICP-MS (Inductively Coupled Plasma Mass Spectrometry)

  • Electron transfer activity measurements

• Biophysical characterization:

  • Circular dichroism to assess secondary structure

  • Dynamic light scattering to verify homogeneity and absence of aggregation

Researchers should also verify the absence of endotoxin contamination if the protein will be used in cell culture or in vivo experiments .

How does MT-CO2 contribute to mitochondrial function in adaptation to metabolic stress?

Recent studies suggest MT-CO2 plays a critical role in adapting to metabolic stress conditions, particularly glucose deprivation. In 2025, researchers demonstrated that glucose deprivation upregulates the expression of MT-CO2, which facilitates glutaminolysis and sustains tumor cell survival under these stress conditions .

The mechanism involves multiple steps:

• Glucose deprivation activates Ras signaling to enhance MT-CO2 transcription

• Simultaneously, glucose deprivation inhibits IGF2BP3 (an RNA-binding protein), stabilizing MT-CO2 mRNA

• Elevated MT-CO2 increases flavin adenosine dinucleotide (FAD) levels

• Increased FAD activates lysine-specific demethylase 1 (LSD1)

• Activated LSD1 epigenetically upregulates JUN transcription

• Increased JUN promotes glutaminase-1 (GLS1) expression and glutaminolysis

• Enhanced glutaminolysis provides alternative energy sources for cell survival

These findings indicate MT-CO2 is indispensable for oncogenic Ras-induced glutaminolysis and tumor growth, suggesting its potential role as a therapeutic target in Ras-driven cancers .

What role does the COX6B1 subunit play in MT-CO2 maturation and assembly?

Recent research from 2025 has revealed that COX6B1 plays a crucial role in MT-CO2 maturation and assembly into functional cytochrome c oxidase complexes. The study demonstrated that:

• COX6B1 knockout (6B1KO) cells show significantly reduced MT-CO2 levels and impaired respiratory capacity

• Re-expression of COX6B1 in knockout cells restores MT-CO2 levels and respiratory function

• COX6B1 is specifically required for MT-CO2 maturation; COX6B2 cannot substitute this function

• MT-CO2 maturation is a redox-sensitive process, and COX6B1 assists in this process

• Expression of alternative oxidase (AOX) in 6B1KO cells restores MT-CO2 maturation by modifying mitochondrial redox status

• COX6B1 is associated with copper delivery to MT-CO2, working with SCO1, SCO2, COA6, and COX16 chaperones

The R20C and R20H variants of COX6B1 show different effects on MT-CO2 maturation and assembly, with R20C causing a more severe assembly defect. This research highlights COX6B1 as instrumental for MT-CO2 maturation, particularly in redox-sensitive copper incorporation processes .

How can comparative studies of Z. hildegardeae MT-CO2 contribute to understanding mitochondrial evolution in rodents?

Comparative studies of Z. hildegardeae MT-CO2 can provide valuable insights into mitochondrial evolution in rodents, particularly those inhabiting the Somali-Masai region. This approach involves:

• Phylogenetic analysis:

  • Constructing phylogenetic trees based on MT-CO2 sequences from various rodent species

  • Using both Bayesian inference (BI) and maximum likelihood (ML) methods

  • Implementing partitioned analyses to improve phylogenetic accuracy

• Species delimitation approaches:

  • Generalized Mixed Yule Coalescent (GMYC)

  • Multi-rate Poisson Tree Process (mPTP)

  • Integration of multiple genetic markers including CYTB, D-loop, BRCA1, and IRBP

• Ecological correlation analysis:

  • Examining MT-CO2 sequence variations in relation to ecological gradients

  • Assessing potential selective pressures on respiratory proteins in different environments

  • Correlating amino acid substitutions with habitat-specific adaptations

• Functional implications:

  • Identifying conserved versus variable regions that may relate to functional constraints

  • Assessing the impact of specific amino acid variations on protein stability and function

  • Conducting comparative protein modeling to visualize structural changes

These approaches can reveal how environmental factors in the Somali-Masai region may have influenced the evolution of mitochondrial proteins, contributing to our broader understanding of adaptive evolution in mammals .

What are common challenges in working with recombinant MT-CO2 proteins and how can they be addressed?

Researchers working with recombinant MT-CO2 proteins frequently encounter several challenges:

• Protein solubility issues:

  • Challenge: MT-CO2 contains hydrophobic transmembrane regions that may cause aggregation

  • Solution: Optimize buffer conditions with appropriate detergents (0.1% Triton X-100 or 0.5% CHAPS); use protein stabilizers like glycerol (5-50%); perform reconstitution at lower protein concentrations

• Maintaining native conformation:

  • Challenge: Recombinant expression may affect proper folding and copper incorporation

  • Solution: Consider co-expression with copper chaperones; supplement expression media with copper; verify copper content using ICP-MS analysis

• Protein degradation:

  • Challenge: MT-CO2 may be susceptible to proteolytic degradation

  • Solution: Include protease inhibitors in all buffers; work at 4°C when possible; avoid repeated freeze-thaw cycles by proper aliquoting

• Functional activity assessment:

  • Challenge: Verifying that recombinant MT-CO2 retains native functionality

  • Solution: Develop activity assays that measure electron transfer capabilities; assess copper binding; perform protein-protein interaction studies with known partners

• Cross-reactivity in immunological applications:

  • Challenge: Antibodies may cross-react with MT-CO2 from other species

  • Solution: Use highly purified protein for immunization; perform extensive validation including Western blots with positive and negative controls; confirm specificity through knockout/knockdown experiments

How can researchers optimize experimental protocols when comparing MT-CO2 from different rodent species?

When conducting comparative studies of MT-CO2 across rodent species, researchers should implement these optimization strategies:

• Sample preparation standardization:

  • Extract tissues using identical protocols across all species

  • For museum specimens, follow specialized protocols for extraction from dried tissues

  • Use the CYTB mini-barcode protocol for older specimens to prevent contamination

• PCR and sequencing optimization:

  • Design primers in conserved regions to work across multiple species

  • Consider using touchdown PCR protocols for difficult templates

  • Implement pyrosequencing on platforms like GS Junior (Roche) for contaminated samples

  • Use |S|E|S|AM|E| Barcode software for analysis of sequences from mixed samples

• Phylogenetic analysis approaches:

  • Determine the best partitioning scheme and substitution models with PartitionFinder

  • Conduct analyses using both Bayesian inference (MrBayes) and maximum likelihood (RAxML)

  • Use high-performance computing clusters for complex analyses

  • Implement multiple species delimitation methods (GMYC, mPTP) for robust results

• Expression system considerations:

  • Use consistent expression systems (E. coli) for all recombinant proteins

  • Standardize purification protocols to minimize method-induced variations

  • Verify protein integrity through identical analytical methods

  • Document any species-specific variations in expression efficiency or protein stability

• Functional comparisons:

  • Develop standardized assays that can be applied consistently across proteins from different species

  • Control for variables such as temperature, pH, and buffer composition

  • Include appropriate positive and negative controls for each species

  • Normalize data to account for species-specific baseline differences

What emerging research areas might benefit from studies involving Z. hildegardeae MT-CO2?

Several promising research areas could benefit from further studies involving Z. hildegardeae MT-CO2:

• Climate adaptation research:

  • Investigation of how MT-CO2 variants correlate with adaptation to different climatic conditions

  • Comparative studies of MT-CO2 from rodent species across varying ecological gradients in Africa

  • Potential insights into mammalian adaptation to climate change

• Bioenergetics and metabolic reprogramming:

  • Exploration of MT-CO2's role in alternative energy pathways during glucose deprivation

  • Comparative studies with human MT-CO2 to identify conserved metabolic adaptation mechanisms

  • Investigation of MT-CO2's interaction network during metabolic stress conditions

• Mitochondrial assembly mechanisms:

  • Detailed mapping of the assembly pathway for MT-CO2 incorporation into Complex IV

  • Identification of species-specific chaperones and assembly factors

  • Elucidation of redox-sensitive steps in MT-CO2 maturation and copper center formation

• Evolutionary medicine approaches:

  • Using rodent MT-CO2 variants to understand human mitochondrial disorders

  • Identification of naturally occurring compensatory mechanisms for MT-CO2 mutations

  • Development of novel therapeutic strategies based on evolutionary insights

• Environmental CO2 sequestration research:

  • Investigation of biological mechanisms for carbon dioxide binding and processing

  • Development of bioinspired approaches for environmental CO2 capture

  • Exploration of MT-CO2's binding properties as a model for synthetic carbon capture systems

How might advances in structural biology techniques enhance our understanding of MT-CO2 function?

Recent and emerging advances in structural biology techniques offer unprecedented opportunities to enhance our understanding of MT-CO2 function:

• Cryo-electron microscopy (Cryo-EM) applications:

  • Near-atomic resolution structures of intact respiratory complexes containing MT-CO2

  • Visualization of dynamic conformational changes during electron transfer

  • Mapping of interaction interfaces between MT-CO2 and other complex IV components

  • Structures of MT-CO2 in different redox states

• Integrative structural biology approaches:

  • Combining X-ray crystallography, NMR, and Cryo-EM data for comprehensive structural models

  • Hydrogen-deuterium exchange mass spectrometry to map conformational dynamics

  • Small-angle X-ray scattering to analyze solution structures and conformational flexibility

• In situ structural studies:

  • Cryo-electron tomography of MT-CO2 within intact mitochondria

  • Correlative light and electron microscopy to link structure with functional states

  • In-cell NMR to analyze MT-CO2 dynamics in cellular environments

• Computational approaches:

  • Molecular dynamics simulations of MT-CO2 in membrane environments

  • Quantum mechanics/molecular mechanics calculations of electron transfer processes

  • Machine learning-based prediction of species-specific structural variations

• Time-resolved structural methods:

  • Serial femtosecond crystallography at X-ray free-electron lasers to capture transient states

  • Time-resolved Cryo-EM to visualize conformational changes during catalysis

  • Pulsed EPR spectroscopy to characterize copper centers during electron transfer