Recombinant Zinc finger protein-like 1 homolog (Y45G12B.2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Proteins are shipped with blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Y45G12B.2; Zinc finger protein-like 1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
Y45G12B.2
Target Protein Sequence
MGLCKCPKRKVTNLFCYEHRVNVCEFCLVDNHPNCVVQSYLTWLTDQDYDPNCSLCKTTL AEGDTIRLNCLHLLHWKCFDEWAANFPATTAPAGYRCPCCSQEVFPPINEVSPLIEKLRE QLKQSNWARAALGLPTLPELNRPVPSPAPPQLKNAPVMHKEVPVHNNRSSTPATHLEMED TASYSVSNNDVTFARKKNYGAESSSDTRPLLQLRDADNEENKYKRRPTMDWMRGLWRAKH GGSGVPQERASAKKIALFVIFLAVLALITIIMVMKRAGYSGEHSSDPLFDPMANPNIRVA VEDSRLPHV
Uniprot No.

Target Background

Database Links
Protein Families
ZFPL1 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • How should recombinant Zinc finger protein-like 1 homolog (Y45G12B.2) be stored and handled for optimal stability?

    For optimal stability, recombinant Zinc finger protein-like 1 homolog should be stored at -20°C, and for extended storage, conserve at -80°C in Tris-based buffer with 50% glycerol . Avoid repeated freeze-thaw cycles as this can lead to protein denaturation and loss of activity. For working solutions, store aliquots at 4°C for up to one week .

    Methodology for handling:

    1. Thaw protein aliquots on ice

    2. Centrifuge briefly before opening to collect all material

    3. Prepare small working aliquots to minimize freeze-thaw cycles

    4. Maintain zinc in buffers (typically 1-10 μM ZnCl₂) as zinc fingers require zinc ions for proper folding

  • What expression systems are most effective for producing functional recombinant Zinc finger protein-like 1 homolog?

    For expression of functional zinc finger proteins, E. coli-based systems (particularly BL21(DE3) strains) often yield high amounts of protein, but eukaryotic systems may provide better folding and post-translational modifications. Based on similar zinc finger protein studies, the following expression systems can be considered:

    Expression SystemAdvantagesLimitationsTypical Yield
    E. coliHigh yield, low cost, rapidPotential misfolding, lack of PTMs10-50 mg/L
    Insect cellsBetter folding, some PTMsModerate cost, longer production time5-20 mg/L
    Mammalian cellsProper folding, complete PTMsHigher cost, lower yield1-10 mg/L
    Cell-free systemsRapid, avoids toxicity issuesHigher cost, smaller scale0.5-5 mg/L

    When expressing zinc finger proteins, supplementing media with ZnCl₂ (50-100 μM) can improve proper folding and functionality .

Advanced Research Questions

  • What DNA sequences does Zinc finger protein-like 1 homolog (Y45G12B.2) potentially recognize, and how can this be experimentally determined?

    The specific DNA sequences recognized by Y45G12B.2 have not been fully characterized, but based on the structure of similar zinc finger proteins, each zinc finger domain typically recognizes 3-4 base pairs .

    To determine binding specificity:

    1. SELEX (Systematic Evolution of Ligands by Exponential Enrichment): Incubate the recombinant protein with a pool of random DNA sequences, wash away unbound sequences, elute and amplify bound sequences, and repeat for 4-6 rounds. Sequence the enriched pool to identify consensus binding motifs.

    2. Protein Binding Microarrays: Expose the protein to microarrays containing all possible DNA sequence variants of a given length, then detect bound protein and analyze preferred sequences.

    3. ChIP-seq: In C. elegans expressing tagged Y45G12B.2, perform chromatin immunoprecipitation followed by sequencing to map genome-wide binding sites.

    4. Site Selection Assay: Similar to the approach used for GNN-binding zinc fingers, where specificity of designs is tested through large-scale site selection experiments .

  • How does the function of Zinc finger protein-like 1 homolog (Y45G12B.2) in C. elegans compare with homologous proteins in other species?

    Y45G12B.2 shows structural similarities to other zinc finger proteins across species, but with distinct functional adaptations. Comparative analysis reveals:

    SpeciesHomologous ProteinSimilarity (%)Functional Role
    C. elegansY45G12B.2100Likely transcription regulation
    MouseEvi3~96Associated with B-cell lymphomas
    HumanEHZFHigh homology to mouse Evi3Expressed in CD34+ hematopoietic progenitors
    Human/RatOAZ/ROAZ63.5/63.2Transcription cofactor in BMP signaling and olfactory epithelium

    The high homology between EHZF and mouse Evi3 (96%) suggests conserved functional roles. EHZF appears restricted to CD34+ stem/progenitor cells in normal hematopoietic systems and may play a role in hematopoiesis regulation and potentially in hematopoietic malignancies .

    To experimentally compare functions:

    1. Perform gene knockdown/knockout studies in respective organisms

    2. Express Y45G12B.2 in mammalian cells to assess functional complementation

    3. Analyze conservation of binding targets across species

  • What role might Zinc finger protein-like 1 homolog (Y45G12B.2) play in neuronal development in C. elegans?

    Based on findings from related zinc finger proteins, Y45G12B.2 may play a role in neuronal development. SC-1, a similar zinc finger protein, is mainly expressed in neuronal tissues . Additionally, studies in C. elegans have shown that zinc finger proteins can affect neuronal structure during aging .

    To investigate this role, researchers should:

    1. Analyze expression patterns of Y45G12B.2 during different developmental stages using:

      • In situ hybridization

      • GFP reporter constructs

      • Immunohistochemistry

    2. Perform RNAi knockdown or CRISPR/Cas9 knockout of Y45G12B.2 and analyze:

      • Neurite outgrowth

      • Synapse formation

      • Neural circuit function

      • Behavioral outcomes

    3. Conduct rescue experiments by expressing the gene in specific neurons to validate phenotypes

    4. Identify potential downstream targets through RNA-seq or ChIP-seq analysis

Experimental Design Considerations

  • What experimental design would be most appropriate for studying the effects of Y45G12B.2 knockout on C. elegans development?

    A robust experimental design would incorporate both between-subjects and within-subjects elements to comprehensively assess developmental effects. Based on established experimental design principles , consider:

    1. Study Design Type: Implement a controlled experimental design with the following groups:

      • Complete knockout (KO) group

      • Tissue-specific conditional KO groups

      • Wild-type control group

      • Heterozygous control group

    2. Variables:

      • Independent variable: Presence/absence of functional Y45G12B.2

      • Dependent variables: Development time, body size, neurite length, locomotion, lifespan

      • Control variables: Temperature, media composition, food availability

    3. Measurement Timeline:

      • Embryonic development (hourly observations)

      • Larval stages (L1-L4, daily observations)

      • Adult stage (observations at days 1, 3, 7, 14, 21)

    4. Statistical Analysis:

      • ANOVA for comparison across multiple groups

      • Survival analysis for lifespan data

      • Repeated measures analysis for longitudinal data

  • How can researchers design a 2×2 factorial experiment to study the interaction between Y45G12B.2 expression and environmental stress in C. elegans?

    A 2×2 factorial design would allow exploration of both main effects and interactions between Y45G12B.2 expression and environmental stress . Consider:

    Independent Variables:

    1. Y45G12B.2 expression: Normal vs. Knocked down (using RNAi)

    2. Environmental stress: Normal conditions vs. Heat stress (30°C)

    Normal ConditionsHeat Stress (30°C)
    Normal Y45G12B.2Group 1: ControlGroup 2: WT + Heat
    Knocked down Y45G12B.2Group 3: RNAi onlyGroup 4: RNAi + Heat

    Experimental Protocol:

    1. Synchronize worm population using hypochlorite treatment

    2. Divide into four groups according to the factorial design

    3. Apply treatments at L3 larval stage

    4. Measure outcomes at 24h, 48h, and 72h post-treatment

    Outcome Measurements:

    • Survival rate

    • Gene expression changes (RNA-seq)

    • Protein expression (Western blot)

    • Behavioral assays (locomotion, pharyngeal pumping)

    Analysis Approach:

    • Assess main effects of each independent variable

    • Analyze interaction effects (whether the effect of Y45G12B.2 knockdown depends on environmental stress)

    • Use two-way ANOVA with post-hoc tests

  • What quasi-experimental approaches can be used when complete knockout of Y45G12B.2 is lethal?

    When complete knockout is lethal, quasi-experimental designs offer alternative approaches to study gene function :

    1. The One-Group Pretest-Posttest Design Using a Nonequivalent Dependent Variable:

      • Induce partial knockdown using temperature-sensitive mutations or controlled RNAi

      • Measure both the primary dependent variable of interest and additional variables not expected to be affected

      • This design helps control for confounding factors

    2. Interrupted Time-Series Design:

      • Make multiple measurements before and after inducing conditional knockdown

      • Example notation: O₁ O₂ O₃ O₄ O₅ X O₆ O₇ O₈ O₉ O₁₀

      • Where O = observation and X = induction of knockdown

      • This design allows detection of immediate and delayed effects

    3. Removed-Treatment Design:

      • Induce knockdown, make observations, then restore gene expression

      • Example notation: O₁ X O₂ O₃ removeX O₄

      • Particularly useful for distinguishing between developmental and physiological roles

    4. Tissue-Specific or Temporal Knockdown:

      • Use tissue-specific promoters or heat-shock inducible systems to restrict knockdown

      • Allows study of tissue-specific functions while maintaining viability

  • How can zinc finger nuclease (ZFN) technology be applied to study Y45G12B.2 function?

    Zinc finger nucleases combine DNA-binding zinc finger domains with the nuclease domain of FokI to create targeted double-strand breaks . For studying Y45G12B.2:

    1. Gene Editing Approaches:

      • Knockout: Design ZFNs targeting Y45G12B.2 exons to create frameshift mutations

      • Knockin: Introduce tags (GFP, FLAG) for localization and protein interaction studies

      • Point Mutations: Create specific amino acid changes to study structure-function relationships

    2. Design Considerations:

      • Each zinc finger typically recognizes 3 base pairs

      • 4-6 zinc fingers are combined to achieve specificity

      • Two ZFN monomers must bind opposite DNA strands with proper spacing (typically 5-7 bp)

    3. Validation Methods:

      • PCR and sequencing to confirm edits

      • Single-strand annealing recombination assay to test ZFN activity

      • Western blotting to confirm protein modification/absence

    4. Applications Beyond Gene Disruption:

      • Tethering transcriptional activators or repressors to zinc fingers to modulate Y45G12B.2 expression

      • Creating fusion proteins to redirect Y45G12B.2 to novel genomic loci

      • Using paired ZFNs to delete larger genomic regions

  • What methodologies can be used to identify protein-protein interactions of Zinc finger protein-like 1 homolog (Y45G12B.2)?

    To comprehensively map the interactome of Y45G12B.2, multiple complementary approaches should be employed:

    1. Affinity Purification-Mass Spectrometry (AP-MS):

      • Express tagged Y45G12B.2 in C. elegans

      • Purify protein complexes using antibodies against the tag

      • Identify interacting partners by mass spectrometry

      • Validate interactions with reciprocal pulldowns

    2. Yeast Two-Hybrid (Y2H) Screening:

      • Use Y45G12B.2 as bait against a C. elegans cDNA library

      • Screen for positive interactions based on reporter gene activation

      • Validate with pairwise Y2H assays and co-immunoprecipitation

    3. Proximity-Based Labeling:

      • Create fusion proteins with BioID or APEX2

      • Allow in vivo biotinylation of proteins in proximity

      • Purify biotinylated proteins and identify by mass spectrometry

    4. Co-Immunoprecipitation with Known Partners:

      • Based on homology with EHZF, test interaction with SMAD proteins

      • Test interaction with BMP signaling pathway components

      • Investigate potential binding to early B-cell factor (EBF)

    Based on the homology with OAZ, Y45G12B.2 might interact with SMAD proteins and components of the BMP signaling pathway, as EHZF has been shown to complex with SMADs 1 and 4 and enhance transcriptional activity of BMP2/4 responsive elements .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.