Recombinant Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Zinc Transport Protein ZntB (zntB)

Recombinant ZntB (zntB) is a bacterial transmembrane protein critical for maintaining zinc homeostasis in prokaryotic organisms, including pathogenic bacteria like Escherichia coli and Salmonella enterica. It belongs to the CorA metal ion transporter (MIT) family but exhibits distinct functional and structural features .

Proton-Coupled Zn²⁺ Uptake

ZntB mediates Zn²⁺ import driven by a proton gradient (Zn²⁺/H⁺ co-transport), as demonstrated by:

  • pH-dependent transport: Zn²⁺ uptake increases under acidic extracellular conditions .

  • Proton ionophore assays: FCCP (a proton ionophore) reverses Zn²⁺ transport direction, confirming H⁺ coupling .

Table 2: Transport Assay Results

Assay TypeConditionsZn²⁺ Transport OutcomeSource
Liposome ReconstitutionpH gradient (ΔpH)Zn²⁺ uptake stimulated by ΔpH
Whole-Cell ExperimentszntB knockout vs. wild-typeReduced Zn²⁺ efflux in mutants
ITC Binding StudiesZn²⁺ affinityThree binding sites identified

Conflicting early reports suggested ZntB as an exporter, but recent studies clarify its role as an importer, driven by intracellular pH gradients .

Therapeutic Potential

ZntB is a candidate target for antimicrobial therapies, as zinc dysregulation disrupts bacterial virulence. Inhibiting ZntB could exploit its role in pathogens like E. coli and Cupriavidus metallidurans .

Research Challenges

Elucidating ZntB’s conformational states during transport remains critical. Cryo-EM structures of full-length ZntB (e.g., PDB: 5N9Y) provide a foundation, but dynamics of proton/Zn²⁺ coordination require further study .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
zntB; c1816; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL
Uniprot No.

Target Background

Function
Mediates the efflux of zinc ions.
Database Links

KEGG: ecc:c1816

STRING: 199310.c1816

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of ZntB in bacterial systems?

  • ZntB mediates Zn²⁺ uptake that is stimulated by a pH gradient across the membrane

  • Expression analysis in C. metallidurans revealed that ZntB is downregulated in high concentrations of Zn²⁺, Cd²⁺, and Cu²⁺, consistent with an import function

  • Reconstitution of ZntB into liposomes demonstrated zinc uptake in radiolabeled and fluorescent transport assays

Methodologically, researchers investigating ZntB function should employ both in vivo cellular assays and in vitro reconstitution experiments to establish directional transport, using pH gradient manipulations to verify the proton-coupled mechanism.

How does ZntB's structure compare to other zinc transporters?

ZntB adopts a homopentameric structure that distinguishes it from other zinc transport protein families:

  • Unlike the ZIP and ZnT families (with 8 and 6 TMDs respectively), ZntB contains only 2 transmembrane domains per monomer

  • The full-length structure of ZntB from E. coli reveals a funnel-shaped pentamer with an extensive cytoplasmic domain

  • ZntB maintains its symmetrical pentameric state even after EDTA treatment, unlike its homolog CorA which collapses into an asymmetrical state in similar conditions

Transporter FamilyMembrane TopologyOligomeric StateDirection of Transport
ZntB (CorA MIT family)2 TMDs per monomerHomopentamerImport (Zn²⁺/H⁺ coupled)
ZIP transporters8 TMDsTypically dimersImport (into cytoplasm)
ZnT transporters6 TMDsTypically dimersExport (from cytoplasm)

For structural studies, researchers should consider combining X-ray crystallography of soluble domains with cryo-EM of full-length protein to capture the complete structural details.

What techniques are most effective for studying ZntB transport activity?

Multiple complementary approaches have proven valuable for characterizing ZntB:

  • Isothermal Titration Calorimetry (ITC): Determines binding affinities for zinc and other divalent cations

  • Radioligand uptake assays: Quantifies zinc transport into ZntB-reconstituted liposomes

  • Fluorescent transport assays: Measures real-time zinc movement using zinc-sensitive fluorophores

  • Cryo-electron microscopy: Resolves full-length structure at moderate resolution (4.2 Å for EcZntB)

  • pH manipulation experiments: Establishes the role of proton gradients in transport

For optimal results, researchers should implement a combination of these techniques, paying particular attention to establishing proper controls for non-specific zinc binding and ensuring physiologically relevant conditions during transport assays.

How is ZntB regulated in bacterial systems?

Regulation of ZntB expression appears to be metal-dependent and species-specific:

  • In C. metallidurans, ZntB expression is downregulated in the presence of high concentrations of Zn²⁺, Cd²⁺, and Cu²⁺

  • The homologous ZntB from Agrobacterium tumefaciens was not induced by treatments with Zn²⁺ in concentrations ranging from 100 to 750 µM

  • ZntB likely works in concert with other zinc homeostasis systems, similar to the controlled shunt of zinc export-import observed in E. coli

Methodologically, researchers studying ZntB regulation should employ quantitative PCR, reporter gene assays, and protein expression analysis under various metal stress conditions to fully characterize its regulatory mechanisms.

What is the molecular mechanism of proton-coupled zinc transport by ZntB?

The proton-coupled zinc transport mechanism of ZntB involves several key structural elements:

  • Transport assays demonstrate that zinc uptake is stimulated by a pH gradient across the membrane

  • Mutagenesis studies have identified residues critical for both zinc binding and proton coupling

  • Molecular dynamics simulations suggest a mechanism where protonation of key histidine and aspartate residues disrupts zinc coordination, facilitating zinc release

A detailed model from recent research indicates:

  • Initial zinc recognition involves a tetrahedral coordination network

  • Protonation events at residues including His43, His251, Asp47, and Asp255 (in human ZnT1, with equivalent residues in ZntB) disrupt this network

  • The alternating access mechanism likely explains how ZntB transports zinc in a Zn²⁺/H⁺ exchange manner

Researchers exploring this mechanism should employ a combination of site-directed mutagenesis, pH-dependent transport assays, and molecular dynamics simulations to fully characterize the proton-zinc coupling mechanism.

How do the structural differences between ZntB and CorA explain their distinct functions?

Despite belonging to the same superfamily, ZntB and CorA display significant structural and functional differences:

  • Symmetry maintenance: ZntB maintains a symmetrical pentameric state even after EDTA treatment, whereas CorA collapses into an asymmetrical state in similar conditions

  • Electrostatic surface potential: Dramatic differences exist between the cytoplasmic domains of ZntB and CorA, with ZntB having a strong positive electrostatic surface potential

  • Pore shape: The pore of ZntB's cytoplasmic domain has a cylindrical shape (12 Å diameter), while CorA's funnel has a conical shape, wide at the cytosolic end and narrow at the top

  • Substrate specificity: ZntB is selective for zinc, while CorA primarily transports magnesium

These structural differences likely account for the distinct transport mechanisms and ion selectivity. For thorough investigation, researchers should use comparative structural biology approaches combined with ion selectivity assays and molecular dynamics simulations.

What are the key metal binding sites in ZntB and how do they contribute to transport?

ZntB contains multiple metal binding sites that participate in transport:

  • In the soluble domain of Salmonella typhimurium ZntB (StZntB), three Zn²⁺ binding sites were identified per monomer :

    • A site coordinated by two adjacent H41 residues (possibly non-physiological)

    • A site on the funnel surface coordinated by C94 and H159

    • A site within the pentamer wall coordinated by H168 and C246

  • In human ZnT1 (related to ZntB), structural Zn²⁺ binding sites were identified at:

    • S^CD1 site (overlapping with sites found in ZnT8/YiiP)

    • S^CD2 site (composed of residues from both protomers)

    • S^CD3 site (close to the TMD/CTD nexus)

Metal Binding SiteLocationCoordinating ResiduesProposed Function
Translocation siteTransmembrane regionHis/Asp tetrahedral coordinationDirect zinc transport
CTD sitesCytoplasmic domainVarious His/Cys/Asp residuesStructural stability and potential regulatory function
Interface siteTMD/CTD nexusMixed residuesFacilitating zinc trapping and subsequent transport

Truncation of the cytoplasmic domain Zn²⁺ sites decreases ZntB activity without disturbing protein expression and surface localization, suggesting their role in the transport mechanism . For comprehensive characterization, researchers should employ site-directed mutagenesis of coordinating residues coupled with transport assays and structural studies.

How can apparent contradictions in the literature regarding ZntB's transport direction be experimentally resolved?

The historical debate about whether ZntB functions as an importer or exporter can be methodologically addressed through:

  • Direct transport measurements in purified systems: Reconstituting ZntB into liposomes with defined orientation and measuring directional zinc flux using radioisotopes or fluorescent indicators

  • Genetic complementation studies: Using ZntB knockout strains complemented with wild-type or mutant ZntB to assess zinc sensitivity/resistance phenotypes

  • Consideration of redundant systems: Accounting for other zinc transporters that may compensate for ZntB function in whole-cell assays, such as PitA, HoxN, ActP, and STM0353

  • Expression pattern analysis: Examining transcriptional regulation of ZntB under varying zinc conditions—downregulation under high zinc suggests an import function

  • Energetic coupling studies: Determining the effect of proton gradients on transport direction, as ZntB appears to function as a Zn²⁺/H⁺ co-transporter

Current evidence strongly supports ZntB functioning as an importer, with earlier contradictory results potentially arising from inadequate consideration of compensatory transport systems and methodological limitations.

What structural transitions occur in ZntB during the transport cycle?

The complete transport cycle of ZntB likely involves several conformational changes:

  • Comparison of full-length ZntB structure with the soluble domain of StZntB provides insight into potential movements that create a pathway for zinc transport

  • Dramatic differences in surface electrostatic potential between different states suggest helical rotation of TM1, which contains conserved basic and acidic residues

  • The charge inversion of the pore surface between symmetrical states might facilitate zinc movement through the pore

  • Molecular dynamics simulations suggest that zinc entry into the translocation funnel stabilizes the tetrahedral network, preparing for subsequent conformational transitions

While the full transport cycle remains to be elucidated, researchers should approach this question using a combination of:

  • Time-resolved structural methods such as hydrogen-deuterium exchange

  • Electron paramagnetic resonance spectroscopy with site-directed spin labeling

  • Single-molecule FRET to capture intermediate states

  • Molecular dynamics simulations at physiologically relevant timescales

How does ZntB interact with other components of bacterial zinc homeostasis systems?

ZntB functions within a broader network of zinc homeostasis proteins:

  • In E. coli, zinc homeostasis involves a controlled shunt of zinc export-import systems including ZupT (ZIP family), ZnuABC (ABC transporter) for import, and ZntA (P-type ATPase), YiiP (cation-diffusion facilitator) for export

  • The regulation of these systems appears coordinated, suggesting interaction at the transcriptional level

  • ZntB may functionally complement other zinc importers, providing redundancy in zinc acquisition strategies

The methodological approach to studying these interactions should include:

  • Transcriptional profiling of all zinc homeostasis genes under varying zinc conditions

  • Construction of multiple knockout strains to identify genetic interactions

  • Protein-protein interaction studies using techniques such as bacterial two-hybrid systems or co-immunoprecipitation

  • Systematic phenotypic characterization of zinc-dependent processes in various genetic backgrounds

Understanding these interactions is crucial for developing a comprehensive model of bacterial zinc homeostasis and potentially identifying targets for antimicrobial development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.