Recombinant Zinc transporter zitB (zitB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Zinc Transporter ZitB

Recombinant Zinc transporter zitB (zitB) is a bioengineered form of the Escherichia coli ZitB protein, a member of the cation diffusion facilitator (CDF) family. This transporter mediates zinc efflux to maintain intracellular zinc homeostasis, particularly under conditions of zinc sufficiency or toxicity . The recombinant protein is typically expressed in heterologous host systems (e.g., E. coli, yeast) for structural, functional, or biotechnological studies .

Protein Structure

ZitB exhibits a conserved CDF architecture:

  • Six transmembrane helices forming two bundles (TM1–TM2–TM4–TM5 and TM3–TM6)

  • Three zinc-binding sites (A, B, C) with conserved residues (e.g., Asp45, His153) critical for metal coordination

  • Cytoplasmic C-terminal domain (CTD) stabilizing dimerization and facilitating alternating-access transport mechanisms

FeatureDescription
Primary Structure312 amino acids (1–312aa) with N-terminal His-tag for purification
Host SystemsE. coli, yeast, baculovirus, mammalian cells
Purity≥85% as verified by SDS-PAGE

Mechanism of Action

ZitB operates via a rocking-bundle mechanism:

  1. Zinc binding: Zn²⁺ coordinates with residues in sites A/B/C, stabilized by conserved aspartate and histidine residues .

  2. Conformational change: TM helices reposition to alternate substrate access between cytoplasm and extracellular space .

  3. Efflux activity: Reduces intracellular Zn²⁺ accumulation by exporting excess ions .

Zinc-Dependent Regulation

ZitB expression is tightly controlled by Zur (zinc uptake regulator) in E. coli:

Zn²⁺ ConcentrationZur Binding ModeZitB Expression Level
Sub-femtomolarDimeric binding to Zur-boxLow
MicromolarOligomeric binding (expanded footprint)High

This biphasic regulation ensures zinc uptake genes are repressed at high Zn²⁺, while exporters like ZitB are activated .

Synergy with Other Transporters

ZitB complements ZntA (P-type ATPase) in E. coli:

  • ZitB: Low-to-moderate zinc concentrations (efflux)

  • ZntA: High zinc toxicity (active efflux)

  • Double disruption: Hypersensitivity to Zn²⁺, indicating overlapping but non-redundant roles

Functional Studies

  • Zinc resistance assays: Overexpression of ZitB increases resistance to Zn²⁺ in zntA-deficient strains .

  • Metal specificity: ZitB exports Zn²⁺ preferentially but also Ni²⁺ and Co²⁺ in Streptomyces coelicolor .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any special requirements for the format. Please specify your preference in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
zitB; STY0799; t2120; Zinc transporter ZitB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Salmonella typhi
Target Names
zitB
Target Protein Sequence
MAHSHSHADSHLPKDNNARRLLFAFIVTAGFMLLEVVGGILSGSLALLADAGHMLTDAAA LLFALLVVQFSRRPPTVRHTFGWLRLTTLAAFVNAIALVVITLLIVWEAIERFYTPRPVA GNLMMVIAVAGLLANLFAFWILHRGSDEKNLNVRAAALHVMGDLLGSVGAIVAALIIIWT GWTPADPILSILVSVLVLRSAWRLLKDSVNELLEGAPVSLDINALQRHLSREIPEVRNVH HVHVWMVGEKPVMTLHAQVIPPHDHDALLERIQDFLMHEYHIAHATIQMEYQMCHGPDCH LNQTPSGHVHHH
Uniprot No.

Target Background

Function
Zinc transporter ZitB (ZitB) is involved in zinc efflux across the cytoplasmic membrane, effectively reducing zinc accumulation within the cytoplasm and enhancing bacterial resistance to zinc. It potentially contributes to zinc homeostasis at low zinc concentrations.
Database Links

KEGG: stt:t2120

STRING: 220341.STY0799

Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the zinc transporter ZitB and what is its primary function in E. coli?

ZitB (formerly YbgR) is a zinc transporter belonging to the Cation Diffusion Facilitator (CDF) family that mediates the efflux of zinc across the plasma membrane of Escherichia coli. ZitB functions primarily in maintaining zinc homeostasis by exporting excess zinc from the cytoplasm to the extracellular space, thus contributing to zinc detoxification mechanisms. It is specifically induced by zinc and plays a crucial role in zinc resistance, particularly at lower zinc concentrations . Unlike some other transporters, ZitB appears to be relatively specific for zinc transport, though it can also transport cadmium. Its expression results in reduced accumulation of zinc in bacterial cells, confirming its role in zinc efflux .

How does ZitB differ from other zinc transporters in E. coli?

ZitB represents one component of a complex zinc homeostasis system in E. coli. While ZntA (a P-type ATPase) is another key zinc efflux transporter, these two systems appear to function at different zinc concentration ranges. Evidence suggests that ZitB contributes to zinc homeostasis at lower, less toxic zinc concentrations, while ZntA becomes essential for growth at higher, more toxic zinc concentrations . This complementary relationship is demonstrated by the observation that single disruption of zitB does not significantly alter zinc sensitivity, whereas double disruption of both zitB and zntA results in hypersensitivity to zinc compared to disruption of zntA alone .

Additionally, unlike ZIP family transporters that generally function in zinc uptake, ZitB functions in zinc efflux. The molecular mechanism of transport also differs - ZitB operates as an antiporter catalyzing the obligatory exchange of Zn²⁺ or Cd²⁺ for H⁺, likely with a 1:1 stoichiometry .

What is the expression pattern and regulation of the zitB gene?

The zitB gene is regulated in a zinc-dependent manner. Transcriptional studies using lacZ reporter fusions have demonstrated that zitB expression is strongly induced by zinc and slightly induced by cadmium, while other metals do not significantly induce its expression . The zinc concentration dependency shows a specific pattern:

  • Induction begins at approximately 50 μM ZnCl₂

  • Expression reaches maximum at approximately 100 μM ZnCl₂ in mineral salts medium

  • Higher zinc concentrations lead to a decrease in zitB expression

This expression pattern aligns with ZitB's proposed role in managing zinc homeostasis at moderate zinc concentrations. Northern blot analysis has confirmed this zinc-dependent increase in zitB-specific transcript .

What is the transport mechanism of ZitB?

  • Depletion of protons stalls Cd²⁺ transport down its diffusion gradient

  • Tetraethylammonium ion substitution for K⁺ does not affect Cd²⁺ transport

  • H⁺ transport shows a hyperbolic relationship with a Km of 19.9 nM for H⁺

  • Applying H⁺ diffusion gradients across the membrane causes Cd²⁺ fluxes against the imposed H⁺ gradients

  • Applying outwardly oriented membrane electrical potential results in Cd²⁺ efflux, demonstrating the electrogenic effect

The exchange stoichiometry of metal ion for proton is likely to be 1:1, making ZitB transport electrogenic .

What are the kinetic parameters of ZitB-mediated zinc transport?

Stopped-flow measurements of transmembrane fluxes of metal ions using reconstituted ZitB in proteoliposomes have provided detailed kinetic parameters. The relationship between transport rate and substrate concentration follows Michaelis-Menten kinetics with the following parameters:

ParameterValue for Zn²⁺Value for Cd²⁺Value for H⁺
Km104.9 ± 5.4 μM90.1 ± 3.7 μM19.9 nM
Transport coupling--Obligatory exchange with metal ions
Rate dependencyLinear function of ZitB to lipid ratio--

These kinetic parameters demonstrate that ZitB has similar affinities for zinc and cadmium, with slightly higher affinity for cadmium .

How does the structural organization of ZitB relate to its function?

While the search results don't provide specific structural details for ZitB itself, we can infer some structural characteristics based on information about CDF family transporters. Generally, ZnT proteins (which like ZitB belong to the CDF family) form homodimers to transport zinc across cellular membranes . The molecular mechanism of zinc transport by CDF family proteins is thought to be dependent on the proton electrochemical gradient, transporting zinc in a Zn²⁺/H⁺ exchange manner via an alternating access mechanism .

For CDF family proteins in general, X-ray crystallography and electron microscopy of bacterial ZnT homologs have provided insights into structural features that might apply to ZitB as well. These studies suggest a transport mechanism that involves conformational changes allowing alternating access to binding sites on either side of the membrane .

What methods are used to study ZitB transport activity in vitro?

Several sophisticated biochemical approaches have been employed to characterize ZitB transport activity:

  • Protein Purification and Reconstitution: ZitB can be purified and reconstituted into proteoliposomes for in vitro transport studies .

  • Stopped-Flow Measurements: This technique allows for real-time monitoring of transmembrane fluxes of metal ions using metal-sensitive fluorescent indicators encapsulated in proteoliposomes .

  • Metal Ion Filling Experiments: These experiments determine how the initial rate of Zn²⁺ influx relates to the molar ratio of ZitB to lipid and to the concentration of metal ions .

  • Ion Substitution Studies: By substituting different ions (e.g., replacing K⁺ with tetraethylammonium), researchers can determine which ions are coupled to metal transport .

  • pH Dependency Studies: These experiments establish the relationship between proton concentration and metal transport rates .

  • Membrane Potential Manipulation: Creating artificial membrane potentials across proteoliposomes helps determine if transport is electrogenic .

How can researchers create and validate zitB mutants for functional studies?

Based on methodologies described in the search results, researchers can employ the following approaches to create and validate zitB mutants:

  • Gene Disruption Techniques: Chromosomal deletions can be performed using methods such as the one described by Datsenko and Wanner, where the gene of interest is replaced by an antibiotic resistance cassette (e.g., chloramphenicol) .

  • P1 Transduction: The disrupted gene construct can be transferred between strains using P1 phage transduction .

  • Functional Validation:

    • Metal sensitivity assays: Testing growth in the presence of various concentrations of zinc and other metals

    • Metal accumulation assays: Measuring intracellular accumulation of radioisotopes like ⁶⁵Zn

    • Double disruption with other transporters (e.g., zntA) to observe additive effects

  • Complementation Studies: Cloning the wild-type zitB gene into an expression vector and introducing it into mutant strains to restore function confirms that phenotypes are due to the specific gene disruption .

What techniques are used to measure ZitB gene expression?

Several methods have been employed to measure zitB gene expression:

  • Transcriptional Fusions: Construction of transcriptional fusions using lacZ as a reporter gene allows quantitative measurement of zitB promoter activity under different conditions .

  • β-Galactosidase Assays: When using lacZ reporter fusions, β-galactosidase activity serves as a quantitative measure of gene expression .

  • Northern Blot Analysis: This technique directly detects and quantifies zitB-specific transcripts .

  • Induction Studies: Testing the effects of various metal ions at different concentrations helps determine the specificity and concentration-dependence of zitB induction .

What methodological challenges exist in studying ZitB function?

Several methodological challenges complicate the study of ZitB function:

  • Functional Redundancy: The presence of multiple zinc transport systems with overlapping functions makes it difficult to isolate the specific contribution of ZitB. This requires creation of multiple gene knockouts and careful phenotypic analysis .

  • In vitro Reconstitution: Purifying and reconstituting functional membrane proteins like ZitB while maintaining their native activity presents technical challenges .

  • Transport Assays: Developing sensitive assays to measure real-time metal ion fluxes requires specialized techniques like stopped-flow spectroscopy with encapsulated fluorescent indicators .

  • Metal Specificity: Distinguishing between transport of different divalent metal ions necessitates careful experimental design and controls .

  • Physiological Relevance: Relating in vitro transport measurements to in vivo function requires integration of multiple experimental approaches .

How might structural studies enhance our understanding of ZitB function?

While the search results don't provide specific structural information for ZitB, insights from structural studies of related transporters suggest potential research directions:

The molecular characterization of ZnT transporters (also in the CDF family) has progressed more than for ZIP transporters. X-ray crystallography and electron microscopy have revealed important structural features of bacterial ZnT homologs that inform understanding of transport mechanisms . Similar structural studies of ZitB could:

  • Identify specific residues involved in zinc binding and transport

  • Reveal the conformational changes associated with the transport cycle

  • Clarify the structural basis for the proposed 1:1 Zn²⁺/H⁺ exchange

  • Provide insights into the electrogenic nature of transport

  • Identify potential sites for regulation or drug targeting

The alternating access mechanism proposed for ZnT proteins based on structural studies could likely apply to ZitB as well, providing a framework for understanding its transport mechanism .

What are potential applications of ZitB research in bacterial physiology and biotechnology?

Understanding ZitB function has several potential applications:

  • Bacterial Physiology: Further elucidating how bacteria maintain zinc homeostasis in various environments could provide insights into bacterial adaptation and survival mechanisms.

  • Antimicrobial Development: Since zinc homeostasis is essential for bacterial viability and virulence, zinc transporters like ZitB could represent targets for novel antimicrobial strategies.

  • Bioremediation: Engineered bacteria with modified zinc transport systems could potentially be used for bioremediation of zinc-contaminated environments.

  • Zinc Biofortification: Understanding bacterial zinc transport might inform strategies for biofortification of foods with essential minerals.

  • Synthetic Biology: ZitB could be utilized in designed cellular systems requiring controlled zinc levels for specific functions.

How might systems biology approaches advance our understanding of ZitB in the context of cellular zinc homeostasis?

Systems biology approaches could significantly enhance our understanding of ZitB function:

  • Network Modeling: Mathematical modeling of the entire zinc homeostasis network, including ZitB, ZntA, and other transporters, could predict system behavior under various conditions.

  • Multi-omics Integration: Combining transcriptomics, proteomics, and metabolomics data could reveal how ZitB expression relates to other cellular processes.

  • Single-Cell Analysis: Studying zinc transport at the single-cell level might reveal heterogeneity in ZitB function within bacterial populations.

  • Synthetic Circuit Design: Creating synthetic regulatory circuits for ZitB could test hypotheses about its regulation and function.

  • Comparative Genomics: Analyzing ZitB homologs across diverse bacterial species could reveal evolutionary adaptations in zinc transport systems.

These approaches could help address the observation from the search results that zinc resistance involves "many systems interacting in an as-yet-undefined way" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.