Recombinant Zinc transporter ZupT (zupT)

Shipped with Ice Packs
In Stock

Description

Table 1: Metal Affinity and Transport Specificity of ZupT

Metal IonBinding SiteAffinity (Relative to Zn²⁺)Transport Efficiency
Zn²⁺M1HighPrimary
Fe²⁺M1 and M2Moderate (M1), High (M2)Secondary (M2)
Cd²⁺M1High (inhibits Zn²⁺ uptake)Non-transported
Mn²⁺M1LowMinimal

Data synthesized from studies in E. coli and structural analyses .

Transport Mechanism and Regulation

ZupT operates via a proton motive force-driven mechanism, independent of zinc availability . Key features include:

  • Constitutive Expression: Unlike the zinc-starvation-induced ZnuABC system, ZupT is expressed under normal conditions .

  • Hand-Off Mechanism: Metal ions bound to M1 are transferred to the exit pathway, while M2-bound Fe²⁺ is directly transported .

  • Competitive Inhibition: Cd²⁺ and Fe²⁺ binding to M1 reduces Zn²⁺ uptake, while Fe²⁺ transport from M2 slightly enhances Zn²⁺ activity via a shared glutamate ligand .

Table 2: Functional Comparison of ZupT and ZnuABC in E. coli

ParameterZupTZnuABC
Expression RegulationConstitutiveZinc-starvation induced
Zinc AffinityLow-to-moderate affinityHigh affinity
Primary Metal TransportZn²⁺ (M1), Fe²⁺ (M2)Zn²⁺
Role in VirulenceSecondary in UTIs Primary in UTIs

Escherichia coli

  • Zinc Uptake: ZupT contributes to Zn²⁺ acquisition but is less efficient than ZnuABC .

  • Pathogenicity: ΔzupT mutants show no disadvantage in urinary tract infections (UTIs), but ΔznuΔzupT strains exhibit severe attenuation in kidneys and bladders .

  • Oxidative Stress Resistance: ZupT loss reduces hydrogen peroxide resistance, linked to impaired zinc-dependent antioxidant systems .

Salmonella Typhimurium

  • Zinc Homeostasis: ΔzupT mutants are hypersensitive to oxidative stress and show reduced intracellular zinc levels .

  • In Vivo Colonization: ZupT is critical for systemic infection in Nramp1 +/+ mice, where host metal limitation is a barrier .

Clostridioides difficile

  • Metal Resistance: ZupT counteracts calprotectin-induced zinc limitation, enabling intracellular zinc accumulation .

  • Complementation: zupT mutants show a 10-fold reduction in Zn²⁺ uptake, restored by recombinant ZupT .

Aeromonas salmonicida

  • Growth and Virulence: ΔzupT strains exhibit impaired motility, biofilm formation, and hemolysis, with reduced colonization in fish models .

  • Temperature-Dependent Regulation: zupT is upregulated at 28°C, correlating with enhanced pathogenicity .

Clinical and Therapeutic Implications

  • Antibiotic Resistance: Zinc homeostasis via ZupT may influence bacterial survival under metal-restricted conditions, such as those imposed by host defense proteins (e.g., calprotectin) .

  • Targeted Interventions: Inhibiting ZupT or its interaction with M1/M2 sites could disrupt metal uptake in pathogens, though no specific inhibitors are yet reported.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have specific format requirements, please specify them in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
zupT; Ecok1_30610; APECO1_3371; Zinc transporter ZupT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Escherichia coli O1:K1 / APEC
Target Names
zupT
Target Protein Sequence
MSVPLILTILAGAATFIGAFLGVLGQKPSNRLLAFSLGFAAGIMLLISLMEMLPAALAAE GMSPVLGYGMFIFGLLGYFGLDRMLPHAHPQDLMQKSVQPLPKSIKRTAILLTLGISLHN FPEGIATFVTASSNLELGFGIALAVALHNIPEGLAVAGPVYAATGSKRTAILWAGISGLA EILGGVLAWLILGSMISPVVMAAIMAAVAGIMVALSVDELMPLAKEIDPNNNPSYGVLCG MSVMGFSLVLLQTAGIG
Uniprot No.

Target Background

Function
Mediates zinc uptake and may also transport other divalent cations.
Database Links
Protein Families
ZIP transporter (TC 2.A.5) family, ZupT subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What methodologies are used to assess ZupT functionality in bacterial systems?

Several complementary approaches can be employed to evaluate ZupT function:

  • Growth assays in zinc-limited media: Comparing growth curves of wild-type, ΔzupT, Δznu, and double mutant strains in zinc-depleted conditions. The Δznu mutants typically show intermediate growth defects, while double mutants (ΔznuΔzupT) exhibit severe growth impairment that can be complemented by plasmid-expressed ZupT .

  • Radioisotope uptake assays: Using ⁶⁵Zn²⁺ to quantify zinc accumulation rates in different genetic backgrounds. In E. coli K-12 and UPEC CFT073, ΔznuΔzupT mutants show dramatically reduced ⁶⁵Zn²⁺ uptake (background levels), which can be restored upon complementation with plasmids encoding either transporter .

  • Competitive infection models: For pathogenic strains, comparing colonization levels of wild-type versus transporter mutants in animal models allows functional assessment in vivo. For instance, competition assays in the murine urinary tract infection model have revealed significant disadvantages for Δznu and ΔznuΔzupT mutants in bladder and kidney colonization .

How can researchers effectively engineer recombinant ZupT for functional studies?

Effective recombinant ZupT production requires careful consideration of expression systems and purification strategies:

  • Plasmid selection: Medium-copy plasmids like those used in the Sabri et al. study (pIJ202) are suitable for ZupT expression studies, offering sufficient expression without toxic overproduction effects .

  • Expression verification: Western blotting with anti-ZupT antibodies or epitope-tagged constructs ensures proper expression.

  • Functional complementation: Confirming activity through rescue of growth defects in ΔznuΔzupT double mutants provides verification of functional expression.

  • Transport assays: Measuring ⁶⁵Zn²⁺ uptake in complemented strains can quantitatively assess recombinant ZupT functionality, with properly functioning recombinant ZupT showing significantly increased zinc accumulation compared to vector controls .

What experimental approaches can distinguish between ZupT's transport of different divalent cations?

Distinguishing between ZupT's transport capabilities for different metals requires sophisticated experimental designs:

  • Competitive transport assays: Measuring ⁶⁵Zn²⁺ uptake in the presence of increasing concentrations of competing metals (Mn²⁺, Fe²⁺) can establish relative substrate preferences and inhibition patterns.

  • Metal-specific growth rescue experiments: Testing the ability of ZupT to restore growth of metal transport mutants (zinc, iron, or manganese) under specific metal-limited conditions can identify which deficiencies ZupT can complement .

  • Site-directed mutagenesis: Modifying predicted metal-binding residues in ZupT followed by functional testing can identify amino acids crucial for specific metal recognition versus general transport function.

  • Isothermal titration calorimetry: With purified protein, direct binding affinities for different metals can be quantified, revealing thermodynamic preferences among potential substrates.

How do ZnuACB and ZupT systems interact in zinc homeostasis during bacterial infection?

The interplay between ZnuACB and ZupT during infection represents a complex research area requiring multiple analytical approaches:

  • Expression profiling: RT-qPCR or RNA-seq analysis of both transporters under infection-relevant conditions reveals coordination patterns. During urinary tract infections, znuACB typically shows upregulation in zinc-limited environments .

  • Sequential mutation studies: Creating and testing single mutants (ΔzupT or Δznu) versus double mutants (ΔznuΔzupT) in infection models allows assessment of their hierarchical importance. In murine UTI models, Δznu mutants show significant colonization defects (4.4-fold reduction in bladder, 41-fold in kidneys), while ΔznuΔzupT double mutants demonstrate even more severe attenuation (30-fold bladder reduction, 48-fold kidney reduction) .

  • Complementation hierarchy studies: Investigating whether overexpression of one system can compensate for the loss of another provides insight into functional redundancy. Published data indicate that ZnuACB plays the predominant role in zinc acquisition during UTI, with ZupT serving as a secondary system .

  • Metal concentration measurements: Quantifying zinc levels in infected tissues alongside bacterial colonization data helps correlate transporter requirements with in vivo zinc availability.

What analytical methods can resolve contradictory findings regarding ZupT function in different bacterial strains?

Resolving strain-specific differences in ZupT functionality requires systematic comparative approaches:

  • Sequence and expression comparison: Analyzing ZupT sequence variations and expression levels across strains may explain functional differences. Promoter strength, regulatory elements, and protein sequence variations should be examined.

  • Standardized functional assays: Conducting identical transport assays across multiple strains under controlled conditions eliminates methodological variables. For example, parallel ⁶⁵Zn²⁺ uptake measurements in K-12 versus pathogenic strains under identical conditions can reveal intrinsic functional differences .

  • Cross-complementation studies: Expressing ZupT from one strain in the ΔzupT background of another strain can identify whether functional differences stem from the protein itself or the cellular context.

  • Contextual expression analysis: Investigating strain-specific differences in the expression of other zinc transporters or zinc-binding proteins can reveal system-level adaptations that influence ZupT's relative importance.

How should researchers design experiments to evaluate ZupT function in zinc-limited conditions?

Proper experimental design for ZupT functional studies requires careful control of zinc availability:

  • Media preparation: Use of chelating agents like EDTA at calibrated concentrations or specialized zinc-depleted media prepared with ultrapure reagents ensures consistent zinc limitation .

  • Control conditions: Including zinc-replete conditions (supplemented with ZnSO₄) alongside zinc-depleted tests provides essential functional contrasts.

  • Strain selection: Using appropriate genetic backgrounds is crucial—K-12 laboratory strains for basic mechanism studies and clinical isolates for pathogenesis investigations show different transporter dependencies .

  • Growth kinetics: Monitoring growth curves rather than endpoint measurements provides more detailed information about zinc transport kinetics and the timing of transport system engagement.

What techniques provide the most reliable quantification of ZupT-mediated zinc transport?

Accurate quantification of ZupT transport activity can be achieved through:

  • Radioisotope uptake kinetics: Measuring time-course of ⁶⁵Zn²⁺ accumulation in cells expressing ZupT versus controls provides direct transport data. In published studies, complementation with plasmid-encoded ZupT in a ΔznuΔzupT background restored ⁶⁵Zn²⁺ uptake significantly above background levels .

  • ICP-MS measurements: Inductively coupled plasma mass spectrometry of cellular zinc content offers sensitive, absolute quantification of transported zinc.

  • Zinc-responsive reporter systems: Fluorescent or luminescent reporters driven by zinc-responsive promoters can provide real-time indicators of intracellular zinc status.

  • Direct transport assays: For purified protein, reconstitution into proteoliposomes allows measurement of zinc movement across membranes under defined conditions.

How should researchers interpret growth and transport data from ZupT studies?

Data interpretation requires careful consideration of multiple factors:

  • Growth curve analysis: When analyzing growth curves of zinc transporter mutants, consider:

    • Lag phase duration (typically extended in transport-deficient strains)

    • Growth rate during exponential phase

    • Final cell density achieved

    In minimal media, CFT073Δznu shows intermediate growth defects, while the double mutant CFT073ΔznuΔzupT exhibits more severe growth impairment, indicating complementary roles .

  • Transport data normalization: ⁶⁵Zn²⁺ uptake measurements should be normalized to cell number or protein content to ensure valid comparisons across strains with different growth rates.

  • Statistical analysis: Apply appropriate statistical tests to determine significance of observed differences, particularly when differences are subtle. Competitive index values from in vivo studies require non-parametric statistical approaches due to typically non-normal distribution .

  • Context-dependent interpretation: Remember that ZupT's relative importance varies by environmental context. In human urine, zinc transport mutants showed no growth defects in vitro despite significant colonization defects in vivo, suggesting differential zinc availability between these environments .

What are the most reliable approaches for comparing ZupT efficiency across different experimental systems?

Standardized comparison methods include:

  • Relative transport efficiency calculation: Calculate the transport efficiency ratio by comparing ⁶⁵Zn²⁺ uptake rates of ZupT to a reference transporter (typically ZnuACB) under identical conditions. Published data indicate ZupT shows lower transport efficiency than ZnuACB when expressed at native levels .

  • Complementation efficiency index: Measure the degree to which recombinant ZupT restores growth or transport in deficient strains compared to wild-type controls.

  • Affinity determination: When possible, determine the apparent Km for zinc binding/transport for objective comparison across systems.

  • Competitive fitness calculations: In mixed infection models, calculating competitive indices provides standardized measures of relative fitness that can be compared across studies .

What are the main challenges in expressing and purifying functional recombinant ZupT?

Researchers face several technical challenges when working with recombinant ZupT:

  • Membrane protein solubility: As a membrane transporter, ZupT presents challenges for expression and purification. Solutions include:

    • Using specialized membrane protein expression systems

    • Employing mild detergents for solubilization

    • Creating fusion constructs with solubility-enhancing partners

  • Maintaining native conformation: Ensuring proper folding and functionality requires:

    • Expression at moderate levels to prevent inclusion body formation

    • Including zinc in growth media to stabilize the protein

    • Verifying activity through functional complementation assays

  • Expression toxicity: Overexpression of membrane transporters can disrupt membrane integrity. This can be addressed by:

    • Using tightly regulated inducible promoters

    • Optimizing induction conditions (temperature, inducer concentration)

    • Selecting appropriate host strains with enhanced membrane protein expression capabilities

How can researchers investigate the structural basis of ZupT transport specificity?

Understanding the structural determinants of ZupT function requires multidisciplinary approaches:

  • Homology modeling: Since ZupT belongs to the ZIP family, structural models can be generated based on related transporters with known structures.

  • Site-directed mutagenesis: Systematic modification of predicted metal-binding residues (particularly histidine and cysteine residues) followed by functional testing can identify critical amino acids for transport.

  • Accessibility studies: Cysteine-scanning mutagenesis combined with sulfhydryl-reactive probes can map accessible regions and conformational changes during transport.

  • Advanced structural methods: For definitive structural insights, techniques like X-ray crystallography or cryo-electron microscopy would be required, though these present significant challenges for membrane transporters.

How do the transport mechanisms of ZupT and ZnuACB differ at the molecular level?

The fundamental differences between these transporters include:

  • Energy coupling: ZnuACB utilizes ATP hydrolysis through its nucleotide-binding domain, while ZupT likely employs a chemo-osmotic gradient for transport .

  • Substrate binding: ZnuA (the periplasmic component of ZnuACB) contains a high-affinity zinc-binding pocket and a distinct histidine-rich loop that enhances zinc acquisition, features absent in ZupT .

  • Transport specificity: ZnuACB demonstrates higher specificity for zinc, while ZupT shows broader substrate recognition, including manganese and iron .

  • Structural organization: ZnuACB functions as a multicomponent system (periplasmic binding protein, transmembrane domain, and nucleotide-binding domain), whereas ZupT operates as a single transmembrane protein.

How does ZupT function compare between pathogenic and non-pathogenic E. coli strains?

Comparative analysis reveals both similarities and differences:

  • Functional conservation: In both E. coli K-12 and UPEC CFT073, ZupT serves as a secondary zinc transporter, with ZnuACB playing the predominant role in zinc acquisition .

  • Relative importance: Loss of ZupT in UPEC strain CFT073 had minimal impact on zinc uptake when ZnuACB was functional, showing similar patterns to non-pathogenic strains .

  • In vivo significance: In pathogenic strains, the relative importance becomes more apparent in infection models. During urinary tract infection, UPEC ΔzupT showed no significant colonization disadvantage when ZnuACB was intact, while Δznu had significant defects, and ΔznuΔzupT showed the most severe attenuation .

  • Environmental adaptation: In human urine, neither single nor double zinc transporter mutants showed growth defects in vitro, suggesting that zinc availability and transporter requirements differ between laboratory and host environments .

What emerging technologies could advance understanding of ZupT function?

Several cutting-edge approaches hold promise for ZupT research:

  • Real-time metal sensing: Development of genetically encoded zinc biosensors with subcellular targeting could allow visualization of ZupT-mediated zinc transport in living cells.

  • Single-molecule tracking: Advanced microscopy techniques could reveal the dynamics of individual ZupT transporters in bacterial membranes.

  • Structural biology advances: Cryo-electron microscopy may overcome challenges in membrane protein crystallography, potentially revealing ZupT's transport mechanism.

  • Systems biology integration: Multi-omics approaches combining transcriptomics, proteomics, and metallomics could provide comprehensive understanding of ZupT's role in bacterial zinc homeostasis networks.

What are the most promising applications of recombinant ZupT systems in bacterial physiology research?

Recombinant ZupT offers several valuable research applications:

  • Metal homeostasis studies: Controlled expression of recombinant ZupT can help dissect zinc acquisition hierarchies in different bacterial species.

  • Antimicrobial development: Understanding zinc acquisition systems including ZupT may identify targets for novel antimicrobials that disrupt bacterial metal homeostasis.

  • Synthetic biology applications: Engineered ZupT variants with modified specificity could enable creation of bacteria with enhanced capabilities for bioremediation of metal-contaminated environments.

  • Host-pathogen interaction models: Recombinant ZupT systems allow investigation of how pathogens compete with hosts for limited zinc resources during infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.