Recombinant Zinnia elegans CLAVATA3/ESR (CLE)-related protein TDIF

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

TDIF is a 12-amino-acid dodecapeptide (HEV(Hyp)SG(Hyp)NPISN) encoded by the CLE41/CLE44 genes in Arabidopsis and homologous genes in Zinnia elegans. It is processed from a full-length precursor protein, which undergoes post-translational modifications, including hydroxylation of proline residues at positions 4 and 7 .

Key Functions:

  • Suppresses tracheary element (TE) differentiation in vascular meristems .

  • Promotes procambial/cambial cell proliferation, maintaining vascular stem cell populations .

  • Non-cell-autonomous regulation: Secreted from phloem cells to act on adjacent procambial cells .

Signaling Pathway and Mechanism

TDIF binds to TDR/PXY, a leucine-rich repeat receptor-like kinase (LRR-RK), triggering downstream signaling:

  1. Receptor Activation: TDIF induces conformational changes in TDR/PXY’s LRR domain, activating the cytoplasmic kinase domain .

  2. Downstream Targets:

    • WOX4/WOX14: Transcription factors promoting vascular cell proliferation .

    • BES1: A transcription factor inhibited by TDIF-TDR signaling to suppress TE differentiation .

Recombinant Production and Applications

Recombinant TDIF is synthesized using heterologous systems to study its function and receptor interactions.

Production Methods

SystemHostProductAdvantagesSources
BaculovirusInsect cellsMature peptide (e.g., HEV(Hyp)SG(Hyp)NPISN)Proper post-translational modifications
E. coliBacterial cellsFull-length precursor or His-tagged TDIFHigh yield, cost-effective

Key Products:

  • CSB-BP375515ZBF1: Partial recombinant TDIF (Baculovirus-expressed) .

  • RFL36487ZF: Full-length His-tagged TDIF (27–132aa, E. coli-expressed) .

Functional Assays

  • TE Differentiation Inhibition: Synthetic TDIF applied to Zinnia mesophyll cultures inhibits xylem formation .

  • Procambial Proliferation: Exogenous TDIF in Arabidopsis enhances vascular development in hypocotyls .

Species-Specific Effects

SpeciesEffectReference
ArabidopsisNo root inhibition; vascular proliferation
Rice/PineMild root inhibition

Future Directions

  1. Bioengineering Vascular Tissues: Leveraging TDIF to enhance wood formation or improve biomass yield .

  2. Structural Insights: Exploring TDIF analogs with modified residues (e.g., V3 substitutions) for enhanced stability or specificity .

  3. Cross-Species Functionality: Investigating TDIF activity in non-model plants (e.g., switchgrass) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery time estimates, please consult your local distributor.
Note: All of our proteins are shipped with standard blue ice packs unless otherwise requested. If dry ice shipping is desired, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please specify it, and we will prioritize its inclusion in the production process.
Synonyms
TDIF; CLAVATA3/ESR; CLE-related protein TDIF; Tracheary element differentiation inhibitory factor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-132
Protein Length
Full Length of Mature Protein
Species
Zinnia violacea (Garden zinnia) (Zinnia elegans)
Target Names
TDIF
Target Protein Sequence
KLRSTSQISHFTNPRSCSSLFFVALLIITILITMLQSSTSMEVTSLPTHQPTSSNSHDES STSSTATTTTDLHPKRTHHQSHPKPTRSFEAGAHEVPSGPNPISNR
Uniprot No.

Target Background

Function
This extracellular signal peptide plays a regulatory role in cell fate determination. It inhibits tracheary element differentiation while promoting the formation of procambial cells adjacent to phloem cells within the veins.
Protein Families
CLV3/ESR signal peptide family
Subcellular Location
[TDIFp]: Secreted, extracellular space.; [CLAVATA3/ESR (CLE)-related protein TDIF]: Cell membrane; Single-pass membrane protein.

Q&A

What is Zinnia elegans CLAVATA3/ESR (CLE)-related protein TDIF and what is its biological significance?

TDIF is a 12-amino acid peptide (HEVHypSGHypNPISN, where Hyp represents 4-hydroxyproline) that belongs to the CLE (CLAVATA3/EMBRYO SURROUNDING REGION-related) peptide family. It was initially isolated from Zinnia elegans mesophyll cell xylogenesis system . TDIF functions as a critical signaling molecule in the regulation of vascular stem cell maintenance and proliferation while simultaneously inhibiting their differentiation into xylem cells. The biological significance of TDIF lies in its role as a phloem-derived non-cell-autonomous signal that controls the fate of procambial/cambial cells (vascular stem cells), thereby establishing and maintaining the proper organization of vascular tissues . This signaling mechanism represents an elegant example of cell-to-cell communication that coordinates tissue development in plants.

How does TDIF signaling regulate vascular development in plants?

TDIF signaling regulates vascular development through a well-characterized molecular pathway. The TDIF peptide is produced in the phloem and secreted into the intercellular space where it binds to its receptor, TDIF RECEPTOR/PHLOEM INTERCALATED WITH XYLEM (TDR/PXY), a leucine-rich repeat receptor-like kinase (LRR-RLK) expressed in procambial cells .

Upon TDIF binding, TDR/PXY activates downstream signaling that:

  • Promotes the proliferation of procambial/cambial cells (vascular stem cells)

  • Suppresses their differentiation into xylem cells

  • Maintains proper organization of vascular tissues

This signaling cascade involves the activation of transcription factors, particularly WUSCHEL HOMEOBOX RELATED 4 (WOX4) and WOX14, which regulate vascular cell proliferation . Additionally, an NAC domain transcription factor, XVP, acts as a negative regulator to fine-tune TDIF signaling .

The non-cell-autonomous nature of TDIF signaling is crucial for establishing proper tissue patterning. TDIF is synthesized in and secreted from phloem and neighboring cells, while its receptor TDR is expressed in procambial cells . This spatial separation creates a directional signaling pathway that helps establish and maintain the proper organization of vascular tissues.

How do TDIF-like genes in switchgrass (Panicum virgatum) compare to those in model plants, and what are their effects when heterologously expressed?

Research has identified five TDIF/TDIFL genes in switchgrass (Panicum virgatum), demonstrating the conservation of this signaling pathway across diverse plant species. Unlike the TDIF genes in Arabidopsis (CLE41 and CLE44) that encode a single CLE motif, some switchgrass TDIF-like genes encode proteins with multiple CLE motifs .

When heterologously expressed in Arabidopsis, PvTDIFL genes caused several phenotypic changes:

PvTDIFL Transgenic LineRoot Length PhenotypeInflorescence HeightVascular Development
35S:PvTDIFL1Significantly reduced40% of wild-typeDisordered
35S:PvTDIFL3-MR2-1No significant changeReducedDisordered
35S:PvTDIFL3-MR3Significantly reducedReducedDisordered

These effects are consistent with previous studies on overexpression of endogenous TDIF genes in Arabidopsis, which also resulted in reduced biomass . Interestingly, this contrasts with findings in Populus, where phloem-specific expression of PttCLE41 increased woody biomass, suggesting that the effects of manipulating TDIF signaling are context-dependent and may vary between herbaceous and woody plants .

How does the TDIF-TDR signaling pathway coordinate vascular stem cell proliferation with xylem differentiation inhibition?

The TDIF-TDR signaling pathway coordinates vascular stem cell proliferation with xylem differentiation inhibition through two independent signaling branches:

  • Proliferation Branch: Upon TDIF binding, TDR/PXY activates WOX4 and WOX14 transcription factors, which promote the division of procambial/cambial cells. This mechanism maintains the pool of vascular stem cells available for tissue formation .

  • Differentiation Inhibition Branch: Simultaneously, TDIF-TDR signaling inhibits the differentiation of procambial cells into xylem elements through a parallel pathway that may involve suppression of genes required for xylem cell differentiation .

Evidence for these parallel pathways comes from experimental observations where WOX4 mutants (wox4-1) still exhibited TDIF-induced inhibition of xylem differentiation despite reduced cell proliferation response . This suggests that while WOX4 is necessary for the proliferation response, the inhibition of xylem differentiation proceeds through a WOX4-independent mechanism.

The dual function of TDIF signaling enables plants to precisely control the balance between maintaining stem cell populations and differentiating functional vascular tissues. This balance is crucial for proper plant development and adaptation to environmental conditions.

How is recombinant Zinnia elegans CLAVATA3/ESR (CLE)-related protein TDIF expressed and purified for research applications?

Recombinant Zinnia elegans TDIF protein can be produced using bacterial expression systems, typically E. coli. Based on available product information and standard recombinant protein production methods, the expression and purification process typically involves:

  • Cloning and Vector Construction:

    • The TDIF coding sequence (amino acids 27-132) is cloned into an expression vector

    • An N-terminal His-tag is added to facilitate purification

    • The construct is transformed into E. coli expression strains

  • Protein Expression:

    • Bacterial cultures are grown to appropriate density

    • Protein expression is induced (typically using IPTG for T7-based expression systems)

    • Cells are harvested and lysed to release the recombinant protein

  • Purification:

    • The His-tagged protein is purified using nickel affinity chromatography

    • Further purification steps may include size exclusion chromatography or ion-exchange chromatography

    • Purity is assessed using SDS-PAGE (typically >90% purity is achieved)

  • Processing and Storage:

    • The purified protein is dialyzed into an appropriate buffer (Tris-based buffer)

    • The protein is formulated with stabilizers (6% trehalose or 50% glycerol)

    • The final product is lyophilized or stored in solution at -20°C/-80°C

    • For working stocks, aliquots should be stored at 4°C for up to one week to avoid freeze-thaw cycles

The recombinant protein has the amino acid sequence: KLRSTSQISHFTNPRSCSSLFFVALLIITILITMLQSSTSMEVTSLPTHQPTSSNSHDESSTSSTATTTTDLHPKRTHHQSHPKPTRSFEAGAHEVPSGPNPISNR .

What experimental approaches can be used to study TDIF function in plants?

Several experimental approaches can be used to study TDIF function in plants:

  • Exogenous Peptide Treatment:

    • Synthetic TDIF peptides can be applied to plant tissues or growth media

    • Effects on vascular development, root growth, and other phenotypes can be observed

    • This approach has been used to demonstrate TDIF's inhibitory effect on xylem differentiation and its promotion of procambial cell proliferation

    • For example, treatment of Arabidopsis seedlings with 1 μM TDIF resulted in discontinuous xylem strands in the higher-order veins of leaves

  • Genetic Approaches:

    • Overexpression of TDIF-encoding genes using constitutive promoters (e.g., 35S) or tissue-specific promoters

    • Loss-of-function analysis using mutants or RNAi-mediated knockdown

    • CRISPR/Cas9 genome editing to modify TDIF genes or components of its signaling pathway

    • Heterologous expression in model systems (e.g., expressing PvTDIFL genes from switchgrass in Arabidopsis)

  • Microscopy and Histological Analysis:

    • Light microscopy and differential staining to visualize vascular tissues

    • Confocal microscopy with fluorescent markers to observe cell division and differentiation

    • Transmission electron microscopy for ultrastructural analysis of vascular tissues

  • Molecular and Biochemical Techniques:

    • In vitro binding assays to study TDIF-receptor interactions

    • Reporter gene assays to monitor pathway activation

    • Transcriptome analysis to identify genes regulated by TDIF signaling

    • Chromatin immunoprecipitation (ChIP) to study transcription factor binding to target genes

How can researchers analyze the effects of TDIF on vascular development and plant growth?

Researchers can analyze the effects of TDIF on vascular development and plant growth through a combination of quantitative and qualitative methods:

  • Quantitative Growth Analysis:

    • Measurement of primary root length

    • Quantification of plant height and stem diameter

    • Determination of biomass (fresh and dry weight)

    • Assessment of inflorescence height and development

    For example, in studies of PvTDIFL expression in Arabidopsis, researchers measured primary root length after 2 weeks of growth on vertical plates and inflorescence height 6 weeks after germination (2 weeks after flowering initiation) .

  • Vascular Tissue Analysis:

    • Cross-sectional analysis of stems to quantify vascular tissue organization

    • Measurement of xylem vessel number, size, and distribution

    • Quantification of procambial cell number and proliferation rate

    • Analysis of vascular pattern in leaves (e.g., continuous vs. discontinuous xylem strands)

  • Molecular Analysis:

    • Expression analysis of genes involved in vascular development

    • Quantification of transcription factor activity (e.g., WOX4, WOX14)

    • Hormone level measurements (auxin, cytokinin) that interact with TDIF signaling

    • Protein-protein interaction studies to analyze receptor complex formation

  • Comparative Analysis:

    • Comparison between wild-type and transgenic/mutant plants

    • Dose-response studies with varying concentrations of synthetic TDIF peptide

    • Temporal analysis of vascular development stages

    • Comparative analysis across different plant species or tissues

A typical experimental design might include:

Analysis TypeControl GroupTreatment GroupParameters MeasuredTime Points
Growth AnalysisWild-type plantsTDIF-treated or transgenic plantsRoot length, plant height, biomass2, 4, 6 weeks
Vascular AnalysisWild-type vascular tissueTDIF-treated or transgenic vascular tissueProcambium width, xylem vessel number1, 2, 3 weeks
Molecular AnalysisBaseline gene expressionTDIF-induced gene expressionWOX4, WOX14, XVP expression levels6, 12, 24, 48 hours

How might manipulation of the TDIF-PXY/TDR signaling pathway be utilized to enhance biomass production in plants?

The TDIF-PXY/TDR-WOX4 signaling pathway presents a promising target for enhancing biomass production in plants through genetic engineering and biotechnological approaches. Research has revealed several strategies:

  • Tissue-Specific Modification: While constitutive overexpression of TDIF genes typically reduces biomass in herbaceous plants like Arabidopsis, phloem-specific expression of PttCLE41 has been shown to increase woody biomass in Populus species . This demonstrates that targeted, tissue-specific manipulation is critical for achieving desired outcomes.

  • Downstream Transcription Factor Manipulation: Overexpression of downstream components like WOX genes offers another approach. For instance, overexpression of the WOX gene STF (STENOFOLIA) improves biomass yields in grasses . Similarly, in hybrid poplar, PttWOX4 genes control cell division activity in the vascular cambium and increase stem girth .

  • Balanced Pathway Regulation: Rather than simple overexpression, fine-tuning the balance between cell proliferation and differentiation signals may be most effective. This could involve modulating both positive regulators (WOX4, WOX14) and negative regulators (XVP) of the pathway.

  • Cross-Species Applications: The identification of TDIF/TDIFL genes in bioenergy crops like switchgrass (Panicum virgatum) provides opportunities to apply these approaches to important biofuel species . Understanding how these genes function in their native context is essential for successful manipulation.

A comparative analysis of different approaches shows:

ApproachPlant SpeciesGenetic ModificationEffect on BiomassReference
Constitutive ExpressionArabidopsis35S:TDIF/TDIFLReduced biomass
Phloem-Specific ExpressionPopulusPhloem-specific PttCLE41Increased woody biomass
Transcription Factor ManipulationGrassesSTF (STENOFOLIA) overexpressionImproved biomass yields
Transcription Factor ManipulationHybrid poplarPttWOX4 manipulationIncreased stem girth

What challenges and considerations must be addressed when studying TDIF activity across different plant species?

Studying TDIF activity across different plant species presents several challenges and considerations that researchers must address:

  • Evolutionary Divergence: TDIF/TDIFL genes have evolved differently across plant species. For example, while Arabidopsis TDIF genes (CLE41 and CLE44) encode single CLE motifs, some switchgrass TDIF/TDIFL genes encode proteins with multiple CLE motifs . This structural diversity may lead to functional differences that must be accounted for in comparative studies.

  • Context-Dependent Effects: The effects of manipulating TDIF signaling vary between different plant types. In Arabidopsis, constitutive TDIF overexpression reduces biomass, while in Populus, phloem-specific expression increases woody biomass . These context-dependent effects highlight the importance of understanding the specific vascular development processes in each species.

  • Technical Considerations:

    • Peptide stability and modification: The proper hydroxylation of proline residues is critical for TDIF function

    • Expression systems: Recombinant protein expression may require optimization for each species

    • Tissue-specific promoters: Availability of well-characterized, tissue-specific promoters varies across species

    • Transformation methods: Efficiency of genetic transformation differs significantly between model and non-model plants

  • Experimental Design Considerations:

    • Developmental timing: Vascular development proceeds at different rates across species

    • Growth conditions: Optimal growth conditions vary between species

    • Tissue sampling: Appropriate tissues for analysis may differ between herbaceous and woody plants

    • Phenotypic assessment: Methods for quantifying vascular development and biomass must be tailored to each species

  • Functional Validation: When transferring knowledge from model to non-model species, functional validation is essential. This may include:

    • Complementation studies

    • Heterologous expression

    • In vitro binding assays

    • Peptide application experiments

These challenges underscore the importance of comprehensive experimental approaches that account for species-specific differences while leveraging the conserved aspects of TDIF signaling across plant lineages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.