Recombinant Zygnema circumcarinatum Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-319
Protein Length
Full Length of Mature Protein
Species
Zygnema circumcarinatum (Green alga)
Target Names
petA
Target Protein Sequence
YPIFAQQNYESPREATGRIVCANCHLAKKPVEIEVPQAVLPDTVFEAVVKIPYDKQINQV LANGKPGGLNVGAVLILPEGFQLAPPERIPPELKEKIGNLYFQPYRPEKSNILVVGPVPG KTYSEMVFPILAPDPSVNKQAYFLKYPIYLGGNRGRGQIYPDGSKSNNTVYNSPVTGTIT SITKNKKGASTVTIITTDNREVVELIPAGPTLLISEGDTVKADQPLTNNPNVGGFGQADA EIVLQDPLRIQGLLVFFASVVLAQIFLVLKKKQFEKVQLAEMNF
Uniprot No.

Target Background

Function
Recombinant *Zygnema circumcarinatum* Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Zygnema circumcarinatum and why is it significant for photosynthesis research?

Zygnema circumcarinatum belongs to the Zygnematophyceae class of green algae (ZGA), which has been identified as the closest relatives of land plants . This evolutionary positioning makes Z. circumcarinatum an important model organism for understanding the transition of photosynthetic mechanisms from aquatic to terrestrial environments. The species forms unbranched filaments, contains two star-shaped chloroplasts per cell, and typically inhabits shallow freshwater environments . Its significance for photosynthesis research stems from its unique position in the green plant lineage and its well-developed photosynthetic machinery, which includes the cytochrome b6f complex containing Apocytochrome f (encoded by petA).

How is strain identity verified when working with Zygnema circumcarinatum?

Strain verification is critical when working with Z. circumcarinatum due to documented cases of mislabeling in culture collections. Proper identification requires molecular analysis of marker genes including:

  • 18S rRNA gene sequencing

  • Chloroplast-encoded genes such as psaA and rbcL

Phylogenetic analysis of these markers should be performed using software like MAFFT for alignment and RAxML for tree construction with appropriate models (e.g., PROTGAMMAJTT) . Researchers should be particularly careful with the widely used SAG 698-1a strain, which molecular evidence suggests may actually be a different Zygnema species, closer to Z. cylindricum than to the true Z. circumcarinatum .

What is Apocytochrome f (petA) and what role does it play in algal photosynthesis?

Apocytochrome f is a crucial component of the cytochrome b6f complex, which serves as the electrical connection between Photosystem II and Photosystem I in the photosynthetic electron transport chain. The protein is encoded by the chloroplast petA gene. In green algae like Zygnema, the cytochrome b6f complex is essential for photosynthetic electron flow and contributes to the establishment of the proton gradient necessary for ATP synthesis. Although specific information about Zygnema's petA gene is limited in the current literature, photophysiological measurements in Zygnema species typically show effective quantum yields (Fq'/Fm) that reflect the efficiency of photosynthetic electron transport in which cytochrome f participates .

What chloroplast transformation methods are applicable for expressing recombinant petA in Zygnema circumcarinatum?

While specific protocols for Zygnema circumcarinatum chloroplast transformation are not extensively documented, principles from other green algal systems can be adapted with appropriate modifications:

  • Particle bombardment: This is the most widely used method for chloroplast transformation in green algae. Gold or tungsten particles coated with DNA containing the recombinant petA gene and appropriate selection markers can be delivered into Zygnema cells using a particle delivery system . The protocol would need adaptation considering Zygnema's filamentous structure.

  • Integration strategy: The recombinant petA gene should be flanked by homologous sequences from the Zygnema chloroplast genome to facilitate integration through homologous recombination . Successful transformants would be selected using appropriate antibiotics.

  • Selection considerations: Selection markers should be chosen carefully, as some conventional markers used in Chlamydomonas may have different efficacy in Zygnema .

A critical challenge specific to Zygnema circumcarinatum is the excessive mucilage surrounding cells, which complicates DNA delivery and extraction procedures . Specialized protocols for removing this mucilage would need to be developed and optimized.

How can researchers address the challenge of extracting high-quality DNA from mucilage-rich Zygnema cultures?

Extracting high molecular weight DNA from Zygnema circumcarinatum presents significant challenges due to copious extracellular polysaccharide mucilage. This mucilage contains homogalacturonan pectins and arabinogalactan proteins that make traditional DNA extraction methods ineffective . Researchers should consider:

  • Mechanical pre-treatment: Physical methods to disrupt mucilage before DNA extraction, potentially including gentle sonication or specialized filtration.

  • Enzymatic approaches: Treatment with pectinases and other cell wall-degrading enzymes may help break down the polysaccharide matrices.

  • Specialized buffers: Extraction buffers containing higher concentrations of detergents or chaotropic agents may improve DNA release from mucilaginous samples.

  • Density gradient centrifugation: This may help separate cellular material from extracellular polysaccharides.

Research teams have needed to develop novel protocols specifically for Zygnema to overcome these challenges during genome sequencing projects .

What verification methods confirm successful expression of recombinant Apocytochrome f?

After transformation, confirming successful expression of recombinant Apocytochrome f requires multiple levels of verification:

  • PCR confirmation: Initial screening of transformants using primers specific to the introduced recombinant petA sequence.

  • Transcript detection: RT-PCR or RNA-Seq to verify transcription of the recombinant petA gene.

  • Protein detection: Western blotting with antibodies specific to Apocytochrome f or to tags incorporated in the recombinant protein .

  • Functional verification: Measuring photosynthetic electron transport parameters using techniques like pulse-amplitude-modulated (PAM) fluorometry to determine if the recombinant protein is functionally integrated into the cytochrome b6f complex.

  • Purification protocol: For detailed biochemical analysis, the recombinant protein can be purified from liquid cultures using appropriate chromatography techniques .

How should experiments be designed to evaluate the impact of recombinant petA expression on photosynthetic efficiency?

Experimental design for evaluating photosynthetic impacts should include:

MeasurementTechniqueParameterRelevance to petA
Photosynthetic EfficiencyPAM FluorometryFq'/Fm (Effective quantum yield)Directly affected by cytochrome b6f function
Electron Transport RatePAM FluorometryrETR (Relative electron transport rate)Quantifies electron flow through cytochrome b6f
Stress ResponseVariable fluorescenceNPQ (Non-photochemical quenching)Secondary effect of altered electron transport
Phenotypic ImpactGrowth measurementsGrowth rate, biomass accumulationHolistic impact of modified petA

Experiments should include appropriate controls:

  • Wild-type Zygnema circumcarinatum

  • Transformants with empty vectors

  • Transformants with non-functional petA mutations

Measurements should be conducted under multiple conditions:

  • Standard growth conditions

  • High light stress (e.g., 400 μmol photons m⁻² s⁻¹)

  • Temperature stress conditions

This comprehensive approach allows assessment of how the recombinant petA affects both normal function and stress responses of the photosynthetic apparatus.

What are the optimal cultivation conditions for maximizing recombinant protein yield in transformed Zygnema?

Optimizing cultivation conditions for recombinant protein expression requires balancing growth parameters with expression efficiency:

  • Light intensity: While Zygnema species have been studied under light intensities ranging from approximately 90-160 μmol photons m⁻² s⁻¹ , optimal conditions for recombinant protein expression may differ. A systematic light intensity gradient experiment is recommended.

  • Temperature regime: Zygnema species exhibit different physiological responses at varying temperatures . Testing a range between 10-25°C is advisable.

  • Media composition: Nutrient availability affects both growth and protein expression. Modified Bold's Basal Medium is commonly used, but systematic testing of nitrogen and phosphorus concentrations may identify optimal conditions.

  • Growth phase harvesting: The timing of harvest is critical - young vegetative cells and pre-akinetes may have different protein expression patterns, as evidenced by their differential responses to environmental stressors .

  • Induction systems: If inducible promoters are used, the timing and concentration of inducers should be optimized.

Record biomass accumulation and protein yield across different conditions to develop a production optimization matrix.

How can researchers distinguish between native and recombinant Apocytochrome f in experimental analyses?

Distinguishing native from recombinant Apocytochrome f requires strategic experimental design:

  • Epitope tagging: Incorporate small epitope tags (His, FLAG, etc.) into the recombinant protein that don't interfere with function but allow specific detection.

  • Site-directed mutations: Introduce silent mutations that alter restriction enzyme sites without changing amino acid sequence, allowing differentiation at the DNA level.

  • Mass spectrometry: Targeted proteomics can identify unique peptides from the recombinant protein, especially if subtle amino acid substitutions have been introduced.

  • RT-PCR with discriminating primers: Design primers that specifically amplify either native or recombinant transcripts.

  • Expression level analysis: Compare total Apocytochrome f levels between wild-type and transformed strains to quantify overexpression.

These approaches can be combined for conclusive discrimination between native and recombinant forms.

How can researchers address the strain identity confusion in the Zygnema circumcarinatum research community?

The documented confusion regarding Zygnema circumcarinatum strain identity presents a significant challenge for research reproducibility. Evidence suggests that SAG 698-1a (labeled as Z. circumcarinatum mating + strain) is actually more closely related to Z. cylindricum than to SAG 698-1b (labeled as Z. circumcarinatum mating - strain) . Researchers should:

  • Perform marker gene verification: Always sequence 18S rRNA, psaA, and rbcL genes for working strains and compare to reference sequences in public databases .

  • Generate phylogenetic trees: Place working strains in phylogenetic context with other verified Zygnema species .

  • Document morphometric data: Record cell dimensions and morphological features as additional verification.

  • Establish reference database: Contribute to community efforts to create a reliable database of verified Zygnema strains.

  • Methodical reporting: In publications, clearly document strain source, identification methods, and reference sequences used for verification.

This systematic approach will help mitigate the confusion caused by historical strain misidentification.

What methods can resolve extraction difficulties with Zygnema's abundant extracellular polysaccharides?

Working with Zygnema's abundant mucilage requires specialized approaches:

  • Extended extraction protocols: For pigment extraction from Zygnema circumcarinatum, researchers have reported needing 2-4 minutes of vortexing compared to 1-2 minutes for other algae, due to the challenging extractability .

  • Increased biomass concentrations: Protocols might require higher starting biomass (e.g., 12 mg DW/mL for Z. circumcarinatum versus 5 mg DW/mL for other algae) .

  • Mechanical disruption: Breaking mucilage-embedded cells often requires direct mechanical disruption, such as stirring up pellets with pipette tips before extraction procedures .

  • Multi-solvent approaches: Combinations of solvents (e.g., methanol followed by acetone with antioxidants like BHT) may be more effective than single-solvent extractions .

  • Multi-step centrifugation: Additional centrifugation steps at maximum speed (≥20,000 rcf) may be necessary to achieve clear extracts free of mucilage contamination .

These adaptations should be systematically implemented and documented when developing protocols for recombinant protein extraction from transformed Zygnema circumcarinatum.

How can researchers account for environmental stress effects when analyzing recombinant petA function?

Environmental stressors significantly impact photosynthetic parameters in Zygnema, potentially confounding analyses of recombinant petA function. Research shows:

  • UV-radiation sensitivity: Zygnema species show variable responses to UV exposure, with young vegetative cells typically adapting better than pre-akinetes . Experiments should control UV exposure or systematically account for its effects.

  • Temperature fluctuations: Temperature stress affects photosynthetic gene expression in Zygnema, including potential downregulation of PDS observed under heat stress (44-fold reduction) and high light conditions (13.5-fold reduction) .

  • High light acclimation: Studies have exposed Zygnema to high light conditions ranging from 400-724 μmol photons m⁻² s⁻¹, showing species-specific photophysiological responses . Researchers should characterize base high light response before attributing changes to recombinant petA.

  • Recovery dynamics: The capacity for recovery after stress differs between cell types and developmental stages in Zygnema . Experimental designs should include recovery periods to distinguish permanent from transient effects.

  • Phenolic compound accumulation: UV-absorbing phenolic compounds increase significantly in young vegetative cells under stress conditions , potentially affecting photosynthetic measurements. These should be quantified alongside functional analyses.

Control experiments should establish baseline stress responses for the specific Zygnema strain used before attributing phenotypic changes to recombinant petA expression.

How can metabolite profiling enhance understanding of recombinant petA impacts on cellular physiology?

Metabolite profiling provides a powerful approach to understanding the broader physiological impacts of recombinant petA expression:

  • Untargeted metabolomics: RP-UHPLC-qToF-MS techniques have successfully profiled Zygnema metabolites, with studies detecting 617 distinct molecular masses, of which approximately 200 could be annotated from databases . This approach can reveal unexpected metabolic consequences of altered electron transport.

  • Targeted analysis of photosynthetic intermediates: Specific analysis of pigments and electron carriers can reveal compensatory responses to altered cytochrome f function.

  • Apocarotenoid signaling networks: Studies show Zygnema circumcarinatum possesses complex oxidative stress signaling networks involving apocarotenoids . Analysis of β-carotene to apocarotenoid ratios before and after recombinant petA expression could reveal impacts on stress signaling.

  • Xanthophyll cycle dynamics: The xanthophyll cycle (measured as AZ/VAZ ratio) is particularly dynamic in Zygnematophyceae under stress conditions and could serve as a sensitive indicator of altered electron transport due to recombinant petA.

  • Integration with transcriptomics: Combining metabolite profiles with transcriptomic data provides more comprehensive understanding of cellular adaptations to altered petA expression.

For accurate interpretation, researchers should develop standardized extraction protocols specific to Zygnema circumcarinatum that account for the mucilage challenges discussed previously.

What evolutionary insights might be gained from comparing native versus recombinant petA function across streptophyte lineages?

Comparative analyses across the streptophyte lineage could reveal important evolutionary insights:

  • Functional conservation: Determining whether recombinant petA from different evolutionary sources (e.g., land plants, other algae) can functionally replace native Zygnema petA would reveal the degree of functional conservation in this component of the photosynthetic apparatus.

  • Adaptive specialization: Zygnematophyceae represent the sister group to land plants and have inherited several traits conferring stress protection . Comparing recombinant petA function under stress conditions could reveal lineage-specific adaptations in electron transport.

  • Co-evolutionary constraints: The cytochrome b6f complex involves multiple interacting proteins. Recombinant petA studies could reveal constraints on co-evolution between petA and other complex components.

  • Regulatory evolution: Comparing expression patterns and regulatory responses of native versus recombinant petA under various conditions could highlight evolutionary changes in photosynthetic gene regulation during the transition to land.

  • Structural adaptations: Detailed structural analysis of recombinant versus native Apocytochrome f could identify specific adaptations that emerged during streptophyte evolution in response to changing environmental conditions.

Such comparative approaches would contribute significantly to understanding photosynthetic evolution during the critical water-to-land transition.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.