Recombinant Zygnema circumcarinatum ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Description

Definition and Genomic Context

The ATP synthase subunit b (atpF) is a core component of the chloroplast ATP synthase complex, responsible for proton translocation across thylakoid membranes and ATP synthesis in photosynthetic organisms. In Zygnema circumcarinatum, a zygnematophyte alga closely related to land plants, the atpF gene is encoded in the chloroplast genome.

Genomic FeatureZygnema circumcarinatumSource
Chloroplast genome size~157–165 kb
atpF gene presenceYes
Gene arrangementSingle-copy, non-rearranged

Key Findings:

  • The atpF gene is conserved in Zygnema chloroplast genomes, as shown in comparative genomics of zygnematophytes and streptophytes .

  • Phylogenetic analyses of Zygnema strains (e.g., SAG 698-1a vs. UTEX 1559) reveal high sequence divergence (85.69% identity) in chloroplast genomes, suggesting species-level differences .

Functional Role and Evolutionary Significance

OrganismATP Synthase SubunitsThylakoid MembranesSource
Zygnema circumcarinatumFull set (atpA–I)Present
Non-photosynthetic cryptophytes8 subunits (atpF pseudogene in Cryptomonas paramecium)Absent

Functional Insights:

  • Zygnema retains a complete ATP synthase complex, supporting active photosynthesis.

  • In non-photosynthetic relatives (e.g., Cryptomonas), gene loss or pseudogenization of atpF correlates with plastid reduction .

Chloroplast Genome Organization

The atpF gene in Zygnema is part of a conserved operon with other ATP synthase subunits. Unlike land plants, Zygnema lacks a large inverted repeat (IR) in its chloroplast genome, a feature shared with other zygnematophytes .

Nuclear Genome Complexity

Nuclear genome sizes in Zygnema strains vary dramatically:

StrainNuclear Genome SizeNotes
SAG 698-1a (mating +)~313 MbLikely Z. cylindricum misidentified as Z. circumcarinatum
SAG 698-1b (mating −)~63.5 MbVerified Z. circumcarinatum

Implications:

  • Strain misidentification has complicated genomic comparisons. For example, SAG 698-1a likely represents Z. cylindricum, not Z. circumcarinatum .

  • The atpF gene’s expression in recombinant systems (e.g., E. coli) has been reported for other organisms (e.g., Guillardia theta) , but no studies confirm its heterologous expression in Zygnema.

Gene Retention in Non-Photosynthetic Algae

OrganismATP Synthase SubunitsPlastid FunctionSource
ZygnemaFull setPhotosynthesis
Cryptomonas paramecium8 subunits (atpF pseudogene)Non-photosynthetic
Nitzschia (colorless diatom)Near-complete setPlastid maintenance

Unresolved Questions and Future Directions

  1. Recombinant Expression: No studies confirm the production of Zygnema atpF in heterologous systems.

  2. Species-Specific Variations: Genomic divergence between Zygnema strains (e.g., SAG 698-1a vs. UTEX 1559) requires functional validation of atpF activity .

  3. Evolutionary Adaptations: The retention of atpF in non-photosynthetic relatives (e.g., Nitzschia) suggests alternative roles, such as plastid maintenance or protein transport .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Zygnema circumcarinatum (Green alga)
Target Names
atpF
Target Protein Sequence
MGERIKSTMDLLIYLQNSHLATGFGFNTNLFETNLINLAVVIGVLVYFGKGVLTTLLNNR KETIVNTIRDAEERYQEATEKLNKAYTRLEQAKAKAEEIRVNGLAQMEIEKQELIKAADE DSKRLEDSKNATLRFEEQRAIEQVRQQVSRLALELALETLKTRLNRDLHAQMIDYHIGLL QSMESVID
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembraneous) and the F(0) membrane proton channel. These domains are linked by a central and a peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the structural and functional role of ATP synthase subunit b (atpF) in Zygnema circumcarinatum?

ATP synthase subunit b (atpF) in Z. circumcarinatum is a critical component of the chloroplastic F-type ATP synthase complex, specifically located in the membrane-embedded F0 region. The protein functions as part of the stationary peripheral stalk (b/b'-stalk) that connects the F1 catalytic domain with the membrane-integrated F0 domain. This stalk acts as a stator, preventing the α3β3 head from rotating with the central γ-stalk during ATP synthesis. In chloroplasts, the ATP synthase complex includes stromal subunits (α3, β3, γ, δ, and ε) in the F1 region and membrane-integrated subunits (a, b, b', and cn) in the F0 region . The b-subunit is essential for maintaining the structural integrity of the complex and facilitating efficient energy coupling between proton translocation and ATP synthesis during photosynthesis.

How does the atpF gene in Z. circumcarinatum compare to homologous genes in other photosynthetic organisms?

The atpF gene in Z. circumcarinatum shows evolutionary conservation among streptophytic algae, reflecting its essential role in photosynthetic energy metabolism. While specific sequence comparisons for Z. circumcarinatum atpF are not comprehensively documented in the provided sources, comparative analyses of plastid genomes among photosynthetic organisms indicate conservation of ATP synthase genes. Photosynthetic chrysophytes and other algal lineages maintain complete sets of ATP synthase complex genes, highlighting their evolutionary importance .

Similar to other chloroplastic F-type ATP synthases, the Z. circumcarinatum complex likely follows the general structural organization seen in plant chloroplasts, with the atpF gene encoding a critical component of the peripheral stalk. The retention of ATP synthase complex genes, including atpF, is a distinguishing feature between photosynthetic organisms and their non-photosynthetic relatives, as evidenced by comparative studies showing gene loss patterns in non-photosynthetic lineages .

What are the expression patterns of atpF in Z. circumcarinatum under different environmental conditions?

Expression patterns of ATP synthase genes in Z. circumcarinatum vary significantly in response to environmental stressors, particularly desiccation. Transcriptomic analyses reveal that photosynthesis-related genes, including those of the ATP synthase complex, are differentially regulated depending on cultivation conditions and stress exposure. In liquid-cultivated Z. circumcarinatum, photosynthesis genes are strongly repressed upon desiccation treatment, while filaments grown on agar plates for extended periods (seven months) show only minor effects on photosynthetic gene expression .

This differential expression correlates with increased desiccation tolerance in mature cultures, suggesting that age-dependent hardening involves transcriptional adaptation of energy metabolism genes. The expression of ATP synthase components, including atpF, likely follows this general pattern, with adaptation mechanisms allowing for maintained energy production during stress in acclimated cultures. These expression patterns reflect the alga's evolutionary adaptation to fluctuating water availability in terrestrial habitats .

How does the recombinant production of Z. circumcarinatum atpF differ from other ATP synthase subunits?

The recombinant production of Z. circumcarinatum atpF presents unique challenges compared to other ATP synthase subunits due to its hydrophobic domains and specific structural requirements. While direct information about atpF production is limited in the provided sources, insights can be drawn from methodology used for other ATP synthase subunits. For instance, the recombinant production of chloroplast ATP synthase subunit c employs a fusion protein approach using maltose binding protein (MBP) to enhance solubility and facilitate purification .

For atpF production, researchers would likely need to:

  • Optimize codon usage for the expression system (typically E. coli)

  • Select appropriate solubilizing fusion partners

  • Develop membrane protein-specific extraction protocols

  • Implement careful refolding strategies to maintain native conformation

The hydrophilic nature of portions of subunit b may require different solubilization approaches compared to highly hydrophobic subunits like subunit c. Expression systems might need modification to accommodate the unique structural features of atpF, potentially incorporating chaperon co-expression or specialized membrane mimetics during purification .

What molecular mechanisms underlie the interaction between atpF and other ATP synthase subunits in Z. circumcarinatum during stress conditions?

Under stress conditions, particularly desiccation, Z. circumcarinatum undergoes significant physiological and molecular adaptations affecting ATP synthase function. The interactions between atpF and other subunits likely incorporate specific modifications to maintain energy production during water limitation. Transcriptomic data indicates that desiccation triggers comprehensive metabolic remodeling, including upregulation of ROS scavenging mechanisms, early light-induced proteins, and membrane modification pathways .

The molecular interactions between atpF and other subunits may involve:

  • Conformational changes in the b-stalk to optimize rotational efficiency during reduced proton gradient conditions

  • Modified protein-protein interactions at the b/δ interface to maintain structural integrity

  • Potential phosphorylation or other post-translational modifications to regulate complex activity

These adaptations would be particularly important in mature cultures, which show enhanced desiccation tolerance compared to young cultures. The membrane modifications observed during desiccation stress likely affect the lipid environment surrounding the ATP synthase complex, potentially altering the hydrophobic interactions involving the membrane-spanning domain of atpF .

How does the stoichiometry of ATP synthase components, including atpF, affect the bioenergetics of Z. circumcarinatum chloroplasts?

The stoichiometry of ATP synthase components critically influences the bioenergetic efficiency of chloroplastic ATP production in Z. circumcarinatum. While the exact stoichiometry in this species is not explicitly documented in the provided sources, principles from other chloroplast ATP synthases indicate that the F-type complex follows a defined subunit ratio that determines the H+/ATP coupling ratio .

For effective energy coupling:

  • The peripheral stalk, including atpF (subunit b), typically exists in a 1:1 ratio with the a-subunit

  • The catalytic F1 head contains three catalytic sites (α3β3)

  • The c-ring stoichiometry (cn) determines how many protons must translocate for each 360° rotation

This relationship can be expressed as:
H+/ATP ratio=n/3\text{H}^+/\text{ATP ratio} = n/3

Where n is the number of c-subunits in the ring. Variations in this stoichiometry would directly affect the bioenergetic efficiency of Z. circumcarinatum, particularly during stress conditions when proton gradients may be limited. The precise balance between atpF and other subunits ensures optimal rotational coupling and prevents energy loss during the mechanical transduction of proton movement to ATP synthesis .

What are the optimal expression systems and conditions for producing recombinant Z. circumcarinatum atpF?

Based on established protocols for similar chloroplastic ATP synthase subunits, the optimal expression system for Z. circumcarinatum atpF would likely involve:

Expression System Selection:

  • E. coli BL21(DE3) or similar strains optimized for membrane protein expression

  • Codon-optimized gene sequence adapted for bacterial expression

  • Use of specialized vectors containing fusion partners (MBP, SUMO, or TrxA) to enhance solubility

Expression Conditions:

  • Induction at lower temperatures (16-18°C) to promote proper folding

  • Reduced IPTG concentration (0.1-0.5 mM) for slower expression

  • Extended expression time (18-24 hours) in rich media supplemented with stabilizing agents

Fusion Strategy:
A dual-tag approach is recommended, combining an N-terminal solubility enhancer (MBP) with a C-terminal purification tag (His6), separated by a precision protease cleavage site. This strategy has proven effective for the chloroplast ATP synthase subunit c, allowing for efficient purification while maintaining proper secondary structure .

What purification strategies maximize yield and maintain structural integrity of recombinant atpF?

A comprehensive purification strategy for Z. circumcarinatum atpF should include:

Initial Extraction:

  • Cell lysis using mild detergents (DDM or LDAO) to solubilize membrane proteins

  • Inclusion of protease inhibitors and stabilizing agents (glycerol 10-15%)

  • Selective extraction under controlled pH (7.5-8.0) and ionic strength

Purification Workflow:

  • Affinity chromatography using the fusion partner (MBP or His-tag)

  • Optional on-column cleavage of fusion partners

  • Size exclusion chromatography to remove aggregates

  • Ion exchange chromatography for final polishing

Structural Integrity Validation:

  • Circular dichroism spectroscopy to confirm alpha-helical content

  • Limited proteolysis to assess proper folding

  • Detergent exchange screening to identify optimal stabilizing conditions

This approach has been successful for obtaining highly purified chloroplast ATP synthase subunits with correct secondary structure, as demonstrated with the c subunit . Adjustments for the specific properties of atpF may include using milder detergents and implementing additional stabilization strategies for the hydrophilic domains.

How can researchers effectively study the interaction between recombinant atpF and other ATP synthase components?

To study interactions between recombinant atpF and other ATP synthase components, researchers can employ multiple complementary approaches:

In Vitro Reconstitution Studies:

  • Co-expression of atpF with interacting partners (particularly δ and a subunits)

  • Step-wise reconstitution in liposomes with defined lipid composition

  • Assessment of functional coupling using proton pumping assays

Protein-Protein Interaction Analysis:

  • Surface plasmon resonance (SPR) to determine binding kinetics

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Cross-linking mass spectrometry to map interaction interfaces

Functional Coupling Assessment:

  • ATP synthesis assays in reconstituted proteoliposomes

  • Proton gradient formation monitoring using pH-sensitive fluorescent probes

  • Rotational analysis using single-molecule techniques

These approaches would be particularly valuable for understanding how atpF from Z. circumcarinatum contributes to the enhanced stress tolerance observed in this species. The interaction studies should be conducted under varying conditions that mimic environmental stressors, particularly desiccation, to uncover adaptation mechanisms .

How should researchers address conflicting data regarding atpF function in different experimental conditions?

When confronting conflicting data regarding atpF function across different experimental conditions, researchers should implement the following systematic approach:

Standardization Analysis Framework:

  • Carefully document all experimental variables (culture age, growth conditions, stress exposure)

  • Perform statistical meta-analysis across experiments with different conditions

  • Develop standardized protocols that control for key variables

Experimental Variables to Document:

VariableExamplesPotential Impact on Results
Culture Age1 month vs. 7 monthsSignificant effect on desiccation response
Growth MediumLiquid vs. Agar platesAlters acclimation to stress conditions
Desiccation ParametersHumidity level, durationAffects magnitude of transcriptional response
Protein Expression SystemE. coli strain, growth temperatureInfluences protein folding and yield
Purification ConditionsDetergents, buffer compositionAffects structural integrity

Researchers should recognize that Z. circumcarinatum shows dramatically different responses to desiccation depending on culture conditions, with liquid-cultivated algae showing strong repression of photosynthesis-related genes while agar-grown cultures exhibit only minor effects . This condition-dependent variability must be accounted for when interpreting atpF functional data.

What bioinformatic approaches are most effective for analyzing atpF sequence and structural data across evolutionary lineages?

For comprehensive evolutionary analysis of atpF across lineages, researchers should employ these bioinformatic approaches:

Sequence Analysis Pipeline:

  • Multiple sequence alignment using algorithms optimized for membrane proteins (MAFFT or T-Coffee)

  • Phylogenetic reconstruction with mixed models accounting for transmembrane domains

  • Selection pressure analysis (dN/dS) focusing on functional domains

  • Ancestral sequence reconstruction to track evolutionary transitions

Structural Bioinformatics Workflow:

  • Homology modeling using available ATP synthase structures as templates

  • Molecular dynamics simulations to assess stability in different membrane environments

  • Coevolution analysis to identify coevolving residue networks

  • Integration of transcriptomic data with structural predictions

Integrative Evolutionary Analysis:

  • Mapping gene loss/retention patterns in non-photosynthetic relatives

  • Correlation of structural features with habitat transitions (aquatic to terrestrial)

  • Comparison with other streptophytic algae to identify convergent adaptations

This multi-layered approach would be particularly valuable for understanding how atpF contributes to the unique adaptations seen in Z. circumcarinatum, especially its remarkable desiccation tolerance compared to related algae .

How can researchers distinguish between direct effects of atpF manipulation and indirect metabolic consequences?

Distinguishing direct effects of atpF manipulation from indirect metabolic consequences requires a multi-faceted experimental design:

Direct vs. Indirect Effects Framework:

  • Temporal Resolution Studies

    • Implement time-course experiments after atpF manipulation

    • Track immediate (0-30 min) vs. delayed (hours-days) responses

    • Analyze rapid phosphorylation or other post-translational modifications

  • Spatial Resolution Approaches

    • Use subcellular fractionation to isolate chloroplasts

    • Employ in organello experiments with purified chloroplasts

    • Compare chloroplastic responses with whole-cell adaptation

  • Targeted vs. Global Analysis

    • Combine targeted assays for ATP synthesis with untargeted metabolomics

    • Implement stable isotope labeling to track metabolic flux

    • Use mathematical modeling to predict metabolic network responses

  • Genetic Controls

    • Create minimal modifications that affect only specific functions

    • Use structure-guided mutagenesis targeting specific interfaces

    • Implement complementation studies with variant forms

These approaches would help researchers parse the complex response networks activated during stress conditions in Z. circumcarinatum, where photosynthetic gene expression, ROS scavenging, membrane modifications, and metabolic remodeling all occur simultaneously .

What are the major challenges in expressing and purifying functional recombinant atpF, and how can they be overcome?

Researchers face several significant challenges when expressing and purifying functional recombinant atpF from Z. circumcarinatum:

Challenge 1: Membrane Protein Solubility

  • Solution: Implement a fusion protein strategy using MBP or SUMO tags to enhance solubility, similar to approaches successful with ATP synthase subunit c . Screen multiple detergent systems including DDM, LDAO, and amphipols for optimal extraction and stability.

Challenge 2: Proper Folding

  • Solution: Lower expression temperature (16-18°C), use specialized E. coli strains like C41(DE3) designed for membrane proteins, and co-express with molecular chaperones. Implement on-column refolding protocols during purification.

Challenge 3: Functional Verification

  • Solution: Develop reconstitution systems in liposomes that mimic the chloroplast membrane composition. Establish functional assays measuring specific aspects of atpF function, such as interaction with the δ-subunit or contribution to proton conductance.

Challenge 4: Low Yield

  • Solution: Optimize codon usage for the expression host, implement auto-induction media for gradual protein expression, and scale up using bioreactor systems with controlled dissolved oxygen and pH. Consider insect cell or cell-free expression systems if bacterial expression proves challenging.

These approaches have been successful with other challenging membrane proteins from photosynthetic organisms, including the chloroplast ATP synthase subunit c, which was successfully expressed using an MBP fusion strategy .

How can researchers accurately assess the functional activity of recombinant atpF in reconstituted systems?

Accurate functional assessment of recombinant Z. circumcarinatum atpF requires specialized approaches for reconstituted systems:

Functional Reconstitution Protocol:

  • Prepare proteoliposomes with defined lipid composition mimicking thylakoid membranes

  • Incorporate recombinant atpF along with minimal interacting partners (δ-subunit, a-subunit)

  • Establish proton gradient using acid-base transition or light-driven proton pumps

  • Monitor functional parameters under varied conditions

Functional Assessment Metrics:

ParameterMeasurement TechniqueExpected Outcome
Complex AssemblyBlue Native PAGEMigration at expected molecular weight of partial/complete complex
Proton ConductancepH-sensitive fluorescent probesGradient maintenance in properly assembled complexes
ATP Synthesis CouplingLuciferase-based ATP quantificationATP production correlating with proton gradient magnitude
Structural IntegrityLimited proteolysis patternsProtection of interaction domains when correctly assembled
Thermal StabilityDifferential scanning fluorimetryIncreased stability when properly assembled with partners

For truly comprehensive assessment, these functional assays should be performed under conditions simulating environmental stressors, particularly desiccation at different relative humidity levels, to understand how atpF contributes to the remarkable stress tolerance observed in mature Z. circumcarinatum cultures .

What novel methodologies could enhance structural studies of atpF in its native membrane environment?

Emerging methodologies offer new opportunities for studying Z. circumcarinatum atpF structure in native-like environments:

Advanced Structural Biology Approaches:

  • Cryo-Electron Microscopy in Nanodiscs

    • Incorporate recombinant atpF into membrane scaffold protein (MSP) nanodiscs

    • Use direct electron detectors and phase plates for high-resolution imaging

    • Implement 3D classification to capture different conformational states

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS)

    • Map solvent accessibility of different atpF domains in various conditions

    • Compare exchange patterns between stress-exposed and control samples

    • Identify regions with altered dynamics during desiccation response

  • Integrative Structural Biology Combining Multiple Techniques

    • Combine low-resolution cryo-EM with high-resolution solid-state NMR

    • Validate models using cross-linking mass spectrometry (XL-MS)

    • Refine structures using molecular dynamics simulations

  • In situ Structural Studies

    • Implement cellular cryo-electron tomography on Z. circumcarinatum

    • Use correlative light and electron microscopy to localize labeled atpF

    • Apply focused ion beam milling for cellular cross-sections

These advanced approaches would provide unprecedented insights into how atpF structure and dynamics contribute to ATP synthase function under the variable environmental conditions that Z. circumcarinatum encounters, particularly during the transition between hydrated and desiccated states that are central to this organism's terrestrial adaptation strategy .

What are the most promising research avenues for understanding atpF's role in Z. circumcarinatum's desiccation tolerance?

The exceptional desiccation tolerance of mature Z. circumcarinatum cultures presents several compelling research opportunities for understanding atpF's role:

Key Research Avenues:

  • Temporal Dynamics of ATP Synthase Remodeling

    • Investigate age-dependent modifications of ATP synthase composition

    • Track atpF expression, modification, and turnover during culture maturation

    • Correlate ATP synthase structural changes with increased desiccation tolerance

  • Comparative Studies Across Terrestrial Adaptation Gradient

    • Compare atpF sequence, structure, and function between Z. circumcarinatum and aquatic relatives

    • Analyze convergent adaptations in ATP synthase components across independently evolved terrestrial lineages

    • Correlate molecular features with ecological distribution and desiccation tolerance thresholds

  • Interaction with Stress Response Networks

    • Investigate cross-talk between ATP synthase regulation and ROS scavenging systems

    • Explore potential regulatory roles of early light-induced proteins on ATP synthase function

    • Map interaction networks between energy production and membrane modification during desiccation

These research directions would build on the observation that desiccation tolerance in Z. circumcarinatum increases dramatically with culture age and is associated with specific transcriptional adaptations that preserve photosynthetic function during water limitation .

How might genetic modification of atpF contribute to engineering stress-tolerant photosynthetic systems?

Strategic genetic modification of atpF presents opportunities for enhancing stress tolerance in both natural and synthetic photosynthetic systems:

Engineering Strategies:

  • Structure-Guided Rational Design

    • Identify key residues mediating stress-specific conformational changes

    • Engineer modified atpF variants with enhanced stability during desiccation

    • Introduce cross-linking sites to stabilize critical interfaces during stress

  • Domain Swapping Approaches

    • Create chimeric atpF proteins incorporating domains from extremophilic organisms

    • Transfer Z. circumcarinatum atpF features to crop chloroplasts for drought tolerance

    • Design minimal atpF variants optimized for specific stress conditions

  • Synthetic Biology Applications

    • Develop orthogonal ATP synthase systems with modified H+/ATP ratios

    • Create synthetic regulatory circuits linking environmental sensing to ATP synthase modification

    • Design artificial protein scaffolds to enhance ATP synthase stability during stress

The differential response observed between young and mature Z. circumcarinatum cultures provides a natural experiment in stress adaptation , offering valuable insights for engineering approaches aimed at enhancing photosynthetic efficiency under adverse conditions.

What interdisciplinary approaches could advance understanding of evolutionary adaptations in ATP synthase components across the green lineage?

Advancing our understanding of ATP synthase evolution in the green lineage requires integrative approaches spanning multiple disciplines:

Interdisciplinary Research Framework:

  • Evolutionary Systems Biology

    • Reconstruct ancestral ATP synthase complexes at key evolutionary transitions

    • Model energetic consequences of stoichiometric variations across lineages

    • Simulate selective pressures driving ATP synthase adaptation in terrestrial environments

  • Eco-Physiological Integration

    • Correlate ATP synthase variations with habitat-specific energy demands

    • Measure in situ performance of ATP synthase under field conditions

    • Develop microfluidic systems to simulate natural fluctuating environments

  • Synthetic Evolutionary Biology

    • Recreate proposed evolutionary intermediates through synthetic biology

    • Test fitness effects of alternative ATP synthase configurations

    • Implement directed evolution under simulated ancestral conditions

  • Computational Phylo-Structural Biology

    • Map sequence changes to structural models across evolutionary time

    • Identify coevolving networks within and between ATP synthase subunits

    • Predict functional consequences of observed evolutionary patterns

These approaches would help contextualize the variations observed between photosynthetic and non-photosynthetic lineages , as well as the specific adaptations seen in Z. circumcarinatum that contribute to its remarkable desiccation tolerance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.