Recombinant Zygnema circumcarinatum Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Zygnema circumcarinatum (Green alga)
Target Names
petD
Target Protein Sequence
MGVTKKPDLTDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVIFGTIACNVGLAVMEPS MIGEPANPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMAAVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTVVSIWLGIGAAMPIDQSLTLGLF
Uniprot No.

Target Background

Function
Component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary significance of Cytochrome b6-f complex in Zygnema circumcarinatum?

The Cytochrome b6-f complex represents a crucial component in the photosynthetic electron transport chain, and studying it in Zygnema circumcarinatum provides valuable insights into the evolution of photosynthesis during land plant emergence. Zygnematophyceae are the sister group to land plants that inherited several traits conferring stress protection . The cytochrome b6-f complex subunit 4 (petD) is particularly important as it contributes to the structural integrity and functional efficiency of the complex. Comparative studies between different strains can reveal evolutionary adaptations, especially considering the variable environmental conditions these algae face in semi-terrestrial habitats.

How do researchers distinguish between different Zygnema strains when working with petD?

Strain identification is critical when working with Zygnema species due to historical misidentification issues. Multiple approaches should be used:

  • Molecular markers: Sequence the 18S rRNA, psaA, and rbcL genes, which are reliable for species differentiation .

  • Morphological analysis: Examine cell width, chloroplast structure, and filament organization .

  • Phylogenetic analysis: Compare your sequences with reference databases.

The importance of correct strain identification has been highlighted by studies showing that SAG 698-1a (previously labeled as Z. circumcarinatum) is actually more closely related to Z. cylindricum . Multiple sequence alignments of marker genes reveal significant differences between strains like SAG 698-1a and SAG 698-1b, with the latter showing 100% identity with UTEX 42 for the rbcL gene .

What is known about the genome size of Zygnema circumcarinatum and its implications for protein studies?

There are significant variations in genome size among Zygnema strains:

StrainNuclear Genome SizeMethod
SAG 698-1a313.2 ± 2.0 MbFlow Cytometry
SAG 698-1b63.5 ± 0.5 MbFlow Cytometry
CAUP K402a~3,000 Mb (3.07 ± 0.06 pg)Older protoplast method

These substantial differences in genome size have significant implications for genetic studies and recombinant protein expression . Researchers should consider these variations when designing primers, expression vectors, and experimental protocols. The larger genome may contain duplicated genes or additional regulatory elements that could affect petD expression and function.

What are the challenges in extracting proteins from Zygnema for recombinant expression?

Extracting proteins or nucleic acids from Zygnema species presents unique challenges due to:

  • Excessive mucilage: Zygnema produces sticky polysaccharides on cell wall surfaces that interfere with traditional extraction methods .

  • Complex extracellular matrix: The presence of homogalacturonan pectins and arabinogalactan proteins (AGPs) creates a protective barrier that is difficult to disrupt .

  • Cell wall composition: The cell walls contain polymers of galacturonic acid, galactose, and arabinose that form mats to retain water against dehydration .

For successful protein extraction, researchers have developed modified protocols based on Galbraith's nuclei extraction method . This approach has been successfully applied in genome sequencing projects and can be adapted for protein studies. The key modifications include additional mechanical disruption steps and specialized buffer compositions to counteract the mucilage interference.

What techniques are recommended for functional characterization of recombinant petD proteins?

For comprehensive functional characterization of recombinant petD proteins from Zygnema circumcarinatum, researchers should employ:

  • Spectroscopic analysis: UV-Vis spectroscopy and circular dichroism to assess proper folding and heme integration.

  • Electron transport assays: Measure electron transfer rates using artificial donors and acceptors.

  • Reconstitution experiments: Incorporate the recombinant protein into liposomes with other purified components of the cytochrome b6-f complex.

  • Chlorophyll fluorescence analysis: Similar to the relative electron transport rate (rETR) measurements used in algal mat studies, which showed differences between top and bottom layers (156.3 vs. 91.5 μmol photons m⁻² s⁻¹) .

What expression systems are suitable for producing recombinant Zygnema petD protein?

Based on related studies, the following expression systems can be considered:

  • E. coli-based systems: Similar to the approach used for C. globosum petD protein, which was successfully expressed with an N-terminal His-tag . This system offers high protein yields but may require optimization for membrane proteins.

  • Algal expression systems: For more authentic post-translational modifications, consider using related algal hosts like Chlamydomonas reinhardtii.

  • Cell-free expression systems: Useful for toxic or membrane proteins that might be challenging to express in living cells.

Regardless of the expression system, the recombinant protein should be designed with appropriate fusion tags (such as His-tag) to facilitate purification and detection . Expression conditions should be optimized for temperature, induction duration, and medium composition to maximize yield and proper folding.

What purification protocols yield highest activity for recombinant petD protein?

Based on protocols used for similar proteins:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using the His-tag .

  • Secondary purification: Size exclusion chromatography to remove aggregates and impurities.

  • Buffer optimization: Use Tris/PBS-based buffers with 6% trehalose at pH 8.0 for final formulation .

  • Storage: Lyophilize the purified protein or store in solution with 5-50% glycerol at -20°C/-80°C to maintain activity .

For reconstitution, dissolve the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Avoid repeated freeze-thaw cycles as they can compromise protein integrity and activity.

How can researchers verify the integrity and functionality of recombinant petD?

A multi-method approach is essential:

  • SDS-PAGE and Western blotting: Confirm protein size and purity (>90% purity is desirable) .

  • Mass spectrometry: Verify the amino acid sequence and post-translational modifications.

  • Circular dichroism: Assess secondary structure elements.

  • Functional assays: Measure electron transport activity using artificial electron donors and acceptors.

  • Interaction studies: Verify binding to other subunits of the cytochrome b6-f complex using co-immunoprecipitation or surface plasmon resonance.

What controls should be included in experiments with recombinant Zygnema petD?

When designing experiments with recombinant Zygnema circumcarinatum petD, include:

  • Positive controls: Well-characterized petD proteins from model organisms like Chlamydomonas reinhardtii.

  • Negative controls: Empty vector expressions or inactive mutant versions of petD.

  • Strain controls: Given the historical confusion with Zygnema strains, include sequence verification of the source strain using multiple marker genes (18S rRNA, psaA, and rbcL) .

  • Functional controls: Include measurements from native cytochrome b6-f complex for comparison.

How can comparative genomics inform petD studies in Zygnema?

Comparative genomics approaches offer valuable context:

  • Gene structure analysis: Compare the petD gene structure across Zygnematophyceae to identify conserved and variable regions.

  • Evolutionary rate analysis: Determine if petD is evolving at rates consistent with other photosynthetic genes.

  • Synteny analysis: Examine the genomic context of petD across related species.

This approach is particularly relevant given the recent findings about chloroplast genome differences. For example, the chloroplast genome of UTEX 1559 shares only 85.69% sequence identity with that of SAG 698-1a, suggesting significant evolutionary divergence that likely affects petD structure and function .

What considerations are important when designing site-directed mutagenesis experiments for Zygnema petD?

When planning mutagenesis studies:

  • Target conserved residues: Identify highly conserved amino acids across streptophyte algae and land plants.

  • Focus on functional domains: Target regions involved in heme binding, electron transfer, and protein-protein interactions.

  • Consider membrane topology: The petD protein is membrane-integrated, so mutations should account for hydrophobic domains and membrane-spanning regions.

  • Design mild mutations first: Begin with conservative substitutions (e.g., similar amino acid properties) before attempting more disruptive changes.

  • Include strain verification: Always sequence key marker genes to verify the Zygnema strain identity before mutagenesis work .

How should researchers analyze spectroscopic data from recombinant petD studies?

Spectroscopic data analysis should include:

  • Baseline correction: Account for buffer contributions and scattering effects.

  • Comparative analysis: Overlay spectra from wild-type and recombinant proteins to identify shifts in absorbance maxima that might indicate structural differences.

  • Peak deconvolution: Separate overlapping spectral components to quantify individual contributions.

  • Time-resolved measurements: For kinetic studies, use appropriate models to extract rate constants.

Chlorophyll fluorescence analysis, similar to that used in algal mat studies showing different rETR max values between layers, can provide insights into electron transport functionality .

What bioinformatic approaches are useful for analyzing petD sequence evolution in Zygnematophyceae?

Robust bioinformatic analysis should include:

  • Multiple sequence alignment: Use algorithms optimized for transmembrane proteins.

  • Phylogenetic tree construction: Employ maximum likelihood or Bayesian methods to infer evolutionary relationships.

  • Selection pressure analysis: Calculate dN/dS ratios to identify sites under positive or purifying selection.

  • Ancestral sequence reconstruction: Infer the ancestral sequence of petD at key evolutionary nodes.

  • Structural modeling: Generate 3D models to visualize the impact of sequence variations on protein structure.

These approaches can help researchers understand how petD has evolved during the transition from aquatic to terrestrial environments and identify adaptations specific to Zygnema circumcarinatum.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.