Recombinant Zygnema circumcarinatum Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Overview of Cytochrome b6 (petB)

Cytochrome b6, encoded by the petB gene, is a core subunit of the cytochrome b₆f complex, which facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI) in oxygenic photosynthesis . In Zygnema circumcarinatum, a filamentous green alga, this protein plays a pivotal role in maintaining photosynthetic efficiency and cyclic electron flow .

Production and Purification

The recombinant protein is expressed in E. coli and purified using affinity chromatography. Key production details include:

Table 2: Production Parameters

ParameterDetails
Expression HostEscherichia coli
TagUndisclosed (determined during production)
Purity>90% (verified by SDS-PAGE)
Storage BufferTris-based buffer with 50% glycerol (pH optimized for stability)
Storage Conditions–20°C (long-term); 4°C (short-term working aliquots)

Repeated freeze-thaw cycles are discouraged to preserve structural integrity .

Research Applications

This recombinant protein is primarily used in:

  • Electron Transport Studies: Investigating kinetics of plastoquinone oxidation and proton translocation .

  • Structural Biology: Crystallization trials to resolve the cytochrome b₆f complex architecture .

  • Mutational Analysis: Assessing the impact of specific residues on complex assembly and function .

Comparative Analysis with Other Species

The Z. circumcarinatum cytochrome b6 shares conserved regions with homologs in plants and cyanobacteria but exhibits unique adaptations:

Table 3: Cross-Species Comparison

FeatureZ. circumcarinatumArabidopsis thalianaProchlorothrix hollandica
Sequence Length215 aa222 aa222 aa
Key MotifsHeme-binding CCCHHeme-binding CCCHHeme-binding CCCH
Expression SystemE. coliNative chloroplastE. coli

Divergences in the N-terminal region suggest species-specific adaptations to light stress or electron transport regulation .

Functional Insights from Related Studies

  • Stability: Loss of small subunits like PetN destabilizes the cytochrome b₆f complex, reducing electron transport efficiency .

  • Regulatory Role: Post-transcriptional RNA processing (e.g., splicing, editing) ensures proper petB expression in chloroplasts .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Zygnema circumcarinatum (Green alga)
Target Names
petB
Target Protein Sequence
MGKVYDWFEERLEIQSIADDITSKYVPPHVNIFYCLGGITLTCFIIQVATGFAMTFYYRP TVTEAFASVQYIMTDVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVILGVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVVGSPIVELLRGSVSVGQTTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6, a component of the cytochrome b6-f complex, plays a crucial role in mediating electron transfer between photosystem II (PSII) and photosystem I (PSI). It also participates in cyclic electron flow around PSI and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome b6 (petB) and what role does it play in photosynthetic organisms?

Cytochrome b6, encoded by the petB gene, is a critical subunit of the cytochrome b6-f complex that plays an essential role in the electron transport chain of photosynthesis. This integral membrane protein functions as an electron carrier, transferring electrons between photosystem II and photosystem I in the thylakoid membrane. The protein contains multiple transmembrane domains and binds heme groups that facilitate electron transfer. In Zygnema circumcarinatum, a green alga, the cytochrome b6 protein consists of 215 amino acids with a sequence that includes highly conserved regions for cofactor binding and electron transport functionality . The protein's role is fundamental to the organism's ability to convert light energy into chemical energy, making it a crucial component of the photosynthetic apparatus.

How does the structure of Z. circumcarinatum Cytochrome b6 differ from other photosynthetic organisms?

The Z. circumcarinatum Cytochrome b6 structure shows both conservation and divergence compared to other photosynthetic organisms. The full amino acid sequence (MGKVYDWFEERLEIQSIADDITSKYVPPHVNIFYCLGGITLTCFIIQVATGFAMTFYYRPTVTEAFASVQYIMTDVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGVILGVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVVGSPIVELLRGSVSVGQTTLTRFYSLHTFVLPLLTA​VFmLMHFLMIRKQGISGPL) reveals distinctive features . Unlike cyanobacterial counterparts such as Prochlorothrix hollandica, which shows a sequence of 222 amino acids , the Z. circumcarinatum protein is slightly shorter. When compared to the petB gene in Synechocystis sp. PCC 6803, which contains 666 nucleotides coding for a 25.02 kDa polypeptide, Z. circumcarinatum lacks the aminoterminal extension of seven amino acids found in non-nitrogen-fixing unicellular cyanobacteria . Additionally, the transmembrane domains and cofactor binding regions show high conservation across species while the connecting loops exhibit greater variability, reflecting evolutionary adaptations to different photosynthetic mechanisms and environmental conditions.

What expression systems are most suitable for producing recombinant Z. circumcarinatum Cytochrome b6?

Several expression systems can be employed for recombinant production of Z. circumcarinatum Cytochrome b6, each with distinct advantages based on research objectives. E. coli and yeast systems offer the best yields and shorter turnaround times for general structural and functional studies . The E. coli system has been successfully used for expressing recombinant cytochrome b6 proteins from other species, such as Prochlorothrix hollandica , suggesting its viability for Z. circumcarinatum as well. For studies requiring proper protein folding and post-translational modifications, insect cells with baculovirus or mammalian cell expression systems may be preferable as they provide many of the post-translational modifications necessary for correct protein folding and activity retention .

The choice of expression system should be guided by specific experimental requirements. For instance, if rapid production and high yield are priorities for preliminary studies, E. coli would be optimal. Conversely, if the research focuses on functional studies where proper protein folding and post-translational modifications are critical, mammalian or insect cell systems would be more appropriate despite their higher cost and complexity.

How can researchers optimize the purification protocol for recombinant Z. circumcarinatum Cytochrome b6 to maintain its structural integrity?

Optimizing purification protocols for recombinant Z. circumcarinatum Cytochrome b6 requires careful consideration of its membrane-associated nature and potential for denaturation. Based on established protocols for similar proteins, a multi-stage approach is recommended. Initially, bacterial cells expressing His-tagged recombinant protein should be lysed under gentle conditions, preferably using enzymatic methods combined with mild detergents rather than harsh sonication that might disrupt protein structure .

For membrane protein extraction, detergent selection is critical—mild non-ionic detergents like n-dodecyl β-D-maltoside (DDM) or digitonin are preferable for preserving the native conformation. Initial purification using immobilized metal affinity chromatography (IMAC) with Ni-NTA resin can be performed under optimized buffer conditions (typically Tris-based buffers with 6% trehalose at pH 8.0) . The elution buffer should contain imidazole at concentrations determined through preliminary gradient testing to minimize co-purification of contaminating proteins.

Further purification may involve size exclusion chromatography (SEC) to separate monomeric protein from aggregates, followed by ion exchange chromatography if additional purity is required. Throughout the process, maintaining a reducing environment with agents like DTT (1-5 mM) helps preserve disulfide bonds in their proper state. For long-term storage, including 50% glycerol and storing at -20°C/-80°C is recommended to prevent freeze-thaw damage . Regular quality control using SDS-PAGE should confirm purity exceeding 90% before proceeding to functional or structural studies.

What spectroscopic techniques are most informative for analyzing the heme coordination environment in recombinant cytochrome b6?

Several spectroscopic techniques provide complementary information about the heme coordination environment in recombinant cytochrome b6. UV-visible absorption spectroscopy represents the foundational approach, where the characteristic Soret band (typically around 410-420 nm) and Q-bands (500-560 nm) provide information about heme iron oxidation state and coordination. Shifts in these bands can indicate whether the recombinant protein maintains native-like heme environments.

Resonance Raman spectroscopy offers more detailed structural information by selectively enhancing vibrations associated with the heme group. This technique can distinguish between different heme types and identify changes in the iron-histidine stretching modes that indicate proper heme coordination. For even more detailed analysis, electron paramagnetic resonance (EPR) spectroscopy can characterize the electronic structure of paramagnetic heme centers, providing information about spin states and the geometry of the iron coordination sphere.

X-ray absorption spectroscopy, particularly X-ray absorption near edge structure (XANES) and extended X-ray absorption fine structure (EXAFS), offers direct information about the local electronic and geometric structure around the iron centers. These techniques are particularly valuable for determining whether the recombinant protein's heme environment matches that of native protein isolated from Z. circumcarinatum. Combined with functional electron transport assays, these spectroscopic approaches can verify whether the recombinant protein maintains its electron transfer capabilities, which is crucial for studies investigating the protein's role in photosynthetic electron transport chains.

How does the amino acid sequence of Z. circumcarinatum Cytochrome b6 influence its integration into the thylakoid membrane?

The amino acid sequence of Z. circumcarinatum Cytochrome b6 contains critical determinants for proper membrane integration and function. Analysis of its sequence (MGKVYDWFEERLEIQSIADDITSKYVPPHVNIFYCLGGITLTCFIIQVATGFAMTFYYRPTVTEAFASVQYIMTDVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGVILGVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVVGSPIVELLRGSVSVGQTTLTRFYSLHTFVLPLLTA​VFmLMHFLMIRKQGISGPL) reveals multiple hydrophobic segments that form transmembrane helices . These hydrophobic regions are crucial for proper insertion into the thylakoid membrane lipid bilayer.

Unlike higher plants that contain introns within the petB gene, the Z. circumcarinatum sequence appears to lack introns, resembling the structure found in cyanobacteria . This genomic organization may influence post-transcriptional processing and ultimately affect protein targeting. The protein likely undergoes post-translational modifications similar to those observed in Synechocystis sp., where three amino acids are removed from the amino terminus . This processing may be essential for proper membrane insertion and assembly into the cytochrome b6-f complex.

The charged and polar residues at the terminal regions and in connecting loops between transmembrane segments play important roles in determining the topology of the protein within the membrane. Positively charged residues often reside on the stromal side of the membrane following the "positive-inside rule" of membrane protein topology. Additionally, specific sequence motifs likely interact with the thylakoid membrane insertion machinery, similar to the SecA/YidC or Tat pathways identified in other photosynthetic organisms. Understanding these sequence determinants is critical for designing experiments to study membrane insertion mechanisms and for engineering modified versions of the protein for structure-function analyses.

What analytical methods are recommended for assessing the purity and integrity of recombinant Z. circumcarinatum Cytochrome b6?

A multi-technique approach is essential for comprehensive assessment of recombinant Z. circumcarinatum Cytochrome b6 purity and integrity. SDS-PAGE represents the primary technique, with expected migration corresponding to approximately 24-25 kDa . Protein preparations should demonstrate purity greater than 90% as determined by densitometric analysis of Coomassie-stained gels .

Western blotting using specific antibodies provides further verification of identity and integrity. While no commercial antibodies specific to Z. circumcarinatum Cytochrome b6 are mentioned in the search results, antibodies against conserved regions of cytochrome b6 from other species may cross-react. The anti-PetD antibody (AS22 4711) that shows reactivity with cytochrome b6-f complex subunits from various species including Synechocystis sp. and Synechococcus sp. might provide useful cross-reactivity .

Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) can determine whether the protein exists in monomeric form or forms higher-order assemblies. Mass spectrometry, particularly liquid chromatography-mass spectrometry (LC-MS), can confirm the exact molecular weight and sequence coverage of the purified protein, including any post-translational modifications or processing events like the removal of N-terminal amino acids observed in related proteins . Circular dichroism spectroscopy provides information about secondary structure content, which should align with predictions based on the primary sequence. UV-visible spectroscopy can verify proper incorporation of heme cofactors through characteristic absorption peaks. Together, these methods provide a comprehensive assessment of protein quality before proceeding to functional or structural studies.

What buffer conditions and storage parameters optimize the stability of recombinant Z. circumcarinatum Cytochrome b6?

Optimal buffer conditions and storage parameters for recombinant Z. circumcarinatum Cytochrome b6 must address several stability challenges inherent to membrane proteins with cofactors. Based on protocols for similar proteins, Tris-based buffers at pH 8.0 provide a suitable environment for maintaining protein stability . The inclusion of osmolytes, particularly trehalose (6%), can significantly enhance protein stability by preventing denaturation and aggregation during freeze-thaw cycles .

Prior to use, vials should be briefly centrifuged to bring contents to the bottom, and gentle thawing at 4°C is preferable to rapid warming, which can lead to protein denaturation . For experiments requiring removal of glycerol, dialysis or buffer exchange using size exclusion chromatography is recommended rather than dilution, which may lead to protein precipitation. If multiple freeze-thaw cycles cannot be avoided, protein activity and integrity should be assessed after each cycle using functional assays and analytical techniques such as SDS-PAGE to monitor potential degradation.

How can researchers effectively reconstitute Z. circumcarinatum Cytochrome b6 into liposomes for functional studies?

Reconstitution of Z. circumcarinatum Cytochrome b6 into liposomes provides a valuable system for functional studies of electron transport and inhibitor binding. An effective protocol builds upon established methods for membrane protein reconstitution with specific adaptations for this photosynthetic protein. The process begins with preparation of liposomes from a mixture of phospholipids that mimic the thylakoid membrane composition, typically including phosphatidylcholine, phosphatidylethanolamine, and phosphatidylglycerol in ratios of 7:2:1.

The lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL before the reconstitution process . Detergent-mediated reconstitution using mild detergents like n-dodecyl β-D-maltoside (DDM) at concentrations just above the critical micelle concentration (CMC) allows for efficient incorporation while minimizing protein denaturation. The protein-detergent-lipid mixture should be incubated at 4°C with gentle agitation, followed by detergent removal using Bio-Beads SM-2 or controlled dialysis.

For functional verification of properly reconstituted proteoliposomes, electron transport assays using artificial electron donors and acceptors can assess whether the protein maintains its native conformation and activity. Spectroscopic techniques, particularly absorbance changes in the presence of oxidizing and reducing agents, provide further evidence of functional reconstitution. Freeze-fracture electron microscopy can verify proper protein incorporation and distribution within the liposomal membrane. This reconstitution system enables studies of electron transport kinetics, inhibitor binding, and interaction with other components of the photosynthetic electron transport chain in a controlled environment.

What approaches can resolve low expression yields of recombinant Z. circumcarinatum Cytochrome b6 in bacterial systems?

Low expression yields of recombinant Z. circumcarinatum Cytochrome b6 in bacterial systems represent a common challenge that can be addressed through systematic optimization. Several factors may contribute to poor expression, including codon bias, protein toxicity, improper folding, and inclusion body formation. A methodical troubleshooting approach should begin with codon optimization for the host organism, particularly for the green algal sequence which may contain codons rarely used in E. coli. Synthetic gene constructs with E. coli-optimized codons typically improve expression levels significantly.

Expression vector selection also plays a crucial role. Vectors with tightly controlled inducible promoters (such as T7lac or araBAD) allow for precise regulation of expression timing and intensity. For membrane proteins like cytochrome b6, lower induction temperatures (16-20°C) and reduced inducer concentrations often improve proper folding by slowing the translation rate. This approach gives the protein more time to incorporate into membranes rather than forming inclusion bodies.

Host strain selection provides another optimization avenue. E. coli strains specifically designed for membrane protein expression, such as C41(DE3) or C43(DE3), often yield better results than standard BL21(DE3) strains. These strains contain mutations that allow them to better tolerate membrane protein overexpression. Additionally, co-expression with molecular chaperones (GroEL/ES, DnaK/J) and heme biosynthesis enzymes can enhance proper folding and cofactor incorporation. For cases where protein toxicity limits growth, the use of tightly regulated expression systems and specialized "walker" strains can help maintain culture viability during expression phases. By systematically addressing these factors, researchers can significantly improve recombinant Z. circumcarinatum Cytochrome b6 yields in bacterial expression systems.

How can researchers distinguish between native and denatured conformations of recombinant Z. circumcarinatum Cytochrome b6?

Distinguishing between native and denatured conformations of recombinant Z. circumcarinatum Cytochrome b6 requires a combination of spectroscopic, biochemical, and functional approaches. UV-visible spectroscopy provides the most accessible initial assessment, as properly folded cytochrome b6 exhibits characteristic absorption spectra with distinct Soret (approximately 410-420 nm) and Q-bands (500-560 nm) from incorporated heme groups. Denatured protein shows significant alterations in these spectral features, particularly a broadening and reduced intensity of the Soret band.

Circular dichroism (CD) spectroscopy offers another powerful approach by measuring the secondary structure content. Native cytochrome b6 should display CD spectra consistent with its predicted α-helical transmembrane structure. Thermal denaturation profiles monitored by CD can assess protein stability and identify conditions that maintain native conformation. Tryptophan fluorescence spectroscopy can provide complementary information, as the emission maximum typically shifts to longer wavelengths when buried tryptophan residues become exposed during denaturation.

Functional assays represent perhaps the most definitive method for assessing native conformation. Electron transfer activity measured using artificial electron donors and acceptors can verify whether the protein maintains its catalytic capabilities. Limited proteolysis experiments also help distinguish between folded and unfolded states, as properly folded proteins typically show resistance to proteolytic digestion compared to denatured counterparts. The native protein should demonstrate specific interaction with known binding partners from the cytochrome b6-f complex, which can be assessed through co-immunoprecipitation or binding assays. Together, these approaches provide comprehensive assessment of whether recombinant Z. circumcarinatum Cytochrome b6 maintains its native conformation.

What strategies can overcome aggregation issues during purification of recombinant Z. circumcarinatum Cytochrome b6?

Aggregation during purification of recombinant Z. circumcarinatum Cytochrome b6 presents a significant challenge that requires targeted strategies addressing the protein's membrane-associated nature. The first intervention point occurs during cell lysis, where gentler disruption methods should be employed alongside adequate detergent solubilization. Screening a panel of detergents (ranging from harsh ionic detergents like SDS to milder non-ionic options like DDM, LMNG, or digitonin) at various concentrations can identify optimal solubilization conditions that maintain protein structure while preventing aggregation.

Buffer optimization represents another critical factor. The inclusion of osmolytes such as trehalose (6%) has been specifically identified as beneficial for maintaining cytochrome b6 stability . Additionally, optimizing ionic strength, typically with 150-300 mM NaCl, can minimize electrostatic interactions that promote aggregation. Anti-aggregation additives like arginine (50-100 mM) or low concentrations of glycerol (5-10%) during purification steps can further stabilize the protein. Maintaining slightly alkaline pH conditions (pH 7.5-8.0) using Tris-based buffers appears optimal based on previous protocols .

The purification workflow itself can be modified to minimize aggregation. Implementing a step-gradient approach rather than harsh elution conditions during affinity chromatography reduces local concentration effects that trigger aggregation. Size exclusion chromatography should be performed promptly after initial purification steps to separate monomeric protein from existing aggregates before they seed further aggregation. For particularly aggregation-prone preparations, on-column refolding during affinity purification may help recover properly folded protein. Temperature control is equally important—maintaining samples at 4°C throughout purification and avoiding freeze-thaw cycles by preparing single-use aliquots with appropriate cryoprotectants (50% glycerol) can significantly reduce aggregation issues during both purification and subsequent storage.

How might structural comparisons between Z. circumcarinatum and cyanobacterial Cytochrome b6 advance understanding of photosynthetic electron transport evolution?

Structural comparisons between Z. circumcarinatum and cyanobacterial Cytochrome b6 offer a unique window into the evolutionary trajectory of photosynthetic electron transport. The green alga Z. circumcarinatum occupies an intermediate evolutionary position between cyanobacteria and higher plants, making its cytochrome b6 structure particularly informative. By comparing the Z. circumcarinatum sequence (215 amino acids) with cyanobacterial counterparts like Prochlorothrix hollandica (222 amino acids) and Synechocystis sp. PCC 6803 , researchers can identify conserved functional domains and lineage-specific adaptations.

Of particular interest is the absence in Z. circumcarinatum of the aminoterminal extension found in non-nitrogen-fixing unicellular cyanobacteria . Detailed structural analysis could reveal whether this represents an evolutionary loss or if it indicates that this extension emerged after the divergence of green algae from the cyanobacterial lineage. Additionally, comparing the transmembrane topology and heme-binding regions could illuminate how electron transport mechanisms have adapted to different cellular environments across evolutionary time.

Advanced research in this area should include comparative analyses of cofactor binding, protein-protein interaction surfaces, and regulatory regions. Cryo-electron microscopy structures of the complete cytochrome b6-f complex from different organisms would provide three-dimensional context for these comparisons. Complementary functional studies measuring electron transport kinetics under various conditions could connect structural differences to functional adaptations. Together, these approaches would illuminate how evolutionary pressures shaped the photosynthetic electron transport chain across diverse photosynthetic lineages, potentially revealing design principles that could inform synthetic biology applications in artificial photosynthesis and bioenergy production.

What potential applications exist for engineered variants of Z. circumcarinatum Cytochrome b6 in artificial photosynthesis systems?

Engineered variants of Z. circumcarinatum Cytochrome b6 hold considerable promise for artificial photosynthesis systems aimed at sustainable energy production. The protein's native role in photosynthetic electron transport makes it an excellent scaffold for engineering enhanced or novel functions. Strategic modifications to the amino acid sequence could produce variants with altered redox potentials, enabling fine-tuning of electron transfer rates in designed systems. These engineered proteins could serve as molecular connectors in biohybrid solar cells, bridging biological light-harvesting components with synthetic catalysts or electrodes.

Site-directed mutagenesis targeting the heme-binding regions could create variants with modified spectral properties or altered substrate specificity. For example, engineering variants with red-shifted absorption profiles could expand the usable solar spectrum in artificial systems. Additionally, increasing the protein's stability under non-native conditions would enhance its utility in various device architectures. This might involve introducing disulfide bridges, optimizing surface charge distribution, or incorporating non-natural amino acids with desired properties.

Another promising direction involves creating fusion proteins that combine the electron transfer capabilities of cytochrome b6 with additional functional domains. For instance, fusions with light-harvesting proteins could create self-contained photosensitive electron transport modules. Similarly, connecting cytochrome b6 with catalytic domains capable of water splitting or carbon dioxide reduction could generate integrated systems for solar fuel production. By leveraging the natural efficiency of Z. circumcarinatum Cytochrome b6 while engineering enhanced or novel functionalities, researchers could develop more efficient and robust artificial photosynthesis systems that address critical sustainable energy challenges.

How could comparative studies between recombinant and native Z. circumcarinatum Cytochrome b6 reveal post-translational modifications critical for function?

Comparative studies between recombinant and native Z. circumcarinatum Cytochrome b6 could uncover critical post-translational modifications (PTMs) that influence protein function, stability, and integration into the photosynthetic apparatus. Such studies would begin with isolation of native cytochrome b6 from Z. circumcarinatum cultures using techniques like thylakoid membrane preparation followed by detergent solubilization and chromatographic purification. In parallel, recombinant protein would be produced using various expression systems, including E. coli and more complex eukaryotic systems capable of performing PTMs.

Mass spectrometry-based proteomics, particularly bottom-up liquid chromatography-tandem mass spectrometry (LC-MS/MS) approaches, would serve as the cornerstone analytical technique. These methods can identify specific PTMs including phosphorylation, acetylation, methylation, and covalent attachment of cofactors. Additionally, top-down mass spectrometry approaches would provide a comprehensive view of the intact protein proteoforms. Evidence from related proteins suggests potential PTMs might include N-terminal processing, as observed in Synechocystis sp. where three amino acids are removed from the amino terminus .

Functional characterization using electron transfer assays would determine how identified PTMs affect protein activity. Structural studies using X-ray crystallography or cryo-electron microscopy could reveal how PTMs influence protein conformation and interaction with partner proteins in the cytochrome b6-f complex. For modifications affecting membrane integration, reconstitution studies comparing native and recombinant protein incorporation into liposomes would be informative. These comparative approaches would not only enhance fundamental understanding of cytochrome b6 biology but could also guide the development of improved expression systems that better recapitulate the native protein state, advancing both basic research and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.